ELF Z@4r4 (44@4@@@p00@0@@@(0PP@P@XX/usr/libexec/ld.so@(@`>@@  p@P ppppp@ ppp p p  A Ni0cj`7 0MRm>h(_bT>Q8IvDSWCFEon !}8Zhe H=T\(U|Ls@VZuTgZ-JPY$c<m'] ~iz:e|;^+kk)1`6gs3o /]4B1M;*Y"mOB  69tXcw_DC][[yuo=-hr_G++Y}^t\9I"F#O`I>K 'p2&n5 1-2Q)pbUDEF, rd:uq/xq;NKwyE5Wx&/<$LCk3%plr# <* Xb {.RaM&[*Vt%f.~VHfyO7PHj:vdj!vz\sU3~zJLl?w2^P 68,xRa@"A,GX9{@(?5 )eKn ?GgiANS7l=fB}%$qa'Q4d{.0SJ|#!4W Z@pFpFpFF(P+( P@`B OFF4&(50F<0dDFhKt*SlEa(Bi$)r@|@C\`DpF``F`FP0F`dE|F8 FTvEF(B xD F `FXF<P) EH(h@.@F47(CFK)TD^dBlnF4x,@ )EPP@@@P**FpFl(*pCd ) B FFpE@FT*ZBl)!pVB (TD0@(?FpDPF\JPF`QF[@Xg*r(FF@|0F4@F\*|/Dd+PD0FXDBp) +F(@x*FT')5)DF8J-BS#B_(@dhFo)y`F4F`B@*)8*.B *{E$-B)+Bx(pF(FLF**"@0Fd8@ AH*J0*R)[D*gl*s *~**0))*)D),)@DP*+*d*$<*,h);)J*[*i){)4) **"B)Atb Chj pFt F @El F F|  F  F4 0F4 F D  F4 PFX l F` F @ \*! F' @ 9 ̿B C pF`I F0P F4W *b C k lx F4 F< @F@ B ( Fl ) pF4 F4 ) ) + B F F4 pF4 F4  FH FT! @2 0l> )H `FDR W ^ +l K Z@RpFY`@d(k(w(}00environ_DYNAMICmainexit__syscall__mainprog_objatexittTdvectprintfNoAliasshortenstringmessageLogLevelsm_syslogprintaddrsendtoliststrncmpstrlenstrcatstrpbrkxallocstrcpyfprintfstabstrcasecmp_ctype_NAliasFileMapssyserrmakemapentrysnprintfbzerostrchrSafeAliascurtimesleep__stat13AutoRebuildgeteuidSuprErrssafefopenerrnoerrstring__fstat13lockfileOpModexfclosesetsignalusernameLineNumberFileNamefgets__srgetCurEnvparseaddrCheckAliasesusrerrungetcfgetcmakelowerfreeVerbosedefineForwardPathexpandincludetransienterrortimectimegmtimelocaltimeblocksignalEventQueueFreeEventListgetpidalarmreleasesignalkillpauseIgnrDotTimeOutsqueuenameFileModedfopenfdopenfinisHasEightBitsSaveFromsetjmpCurHostNameseteventTrafficLogFile__swbufSevenBitInputMaxMessageSizebcopyisheaderchompheaderclreventfflushSuperSafefsyncfcloseflush_errorsRealHostNameInChildExitStateatheaderGrabTomarkstatshvalueNoRecipientActionaddheaderMimeModefopenlongjmpfreopenMyHostNameQueueDirfreediskspacestrncpyarpadateSpaceSubQueueLARefuseLAWkRecipFactWkClassFactWkTimeFactQueueFactorRealUidCheckpointIntervalMaxHopCountMciCacheTimeoutDefUidDefGidMaxMciCacheinittimeoutsPrivacyFlagsServiceSwitchFileServiceCacheMaxAgeHostsFilePidFileMustQuoteCharsMciInfoTimeoutMaxRuleRecursionColonOkInAddrDontLockReadFilesDoubleBounceAddrMaxAliasRecursionMaxMacroRecursionDeadLetterDropsetupheadersDefUsermakemailermap_parseargshash_map_opendb_map_closedb_map_lookupdb_map_storebt_map_opennis_map_opennull_map_closenis_map_lookupnull_map_storenull_map_openbestmx_map_lookuphost_map_inithost_map_lookuptext_map_opentext_map_lookupstab_map_openstab_map_lookupstab_map_storeimpl_map_openimpl_map_closeimpl_map_lookupimpl_map_storeuser_map_openuser_map_lookupdequote_initdequote_mapudb_map_lookupprog_map_lookupseq_map_parseseq_map_lookupseq_map_storeswitch_map_opennull_map_lookupConfigLevelstrcmpServiceCacheTimeConfigFileReadgetloginttynamesignalsigblocksigsetmaskVendorCodegetloadavgperrorCurrentLAConnRateThrottlesetproctitleMinBlocksFreeMaxChildrenCurChildrenproc_list_probewaitproc_list_dropwaitpidgetdtablesizestrerrorwordinclasssetusershellgetusershellendusershellstatfsflockfcntldumpfdChownAlwaysSafefpathconfsetrlimitConfFileanynet_ntoarscheckhosts_ctlgethostbynameshorten_hostnamegethostbyaddrgetpwnamgetpwuidsocketioctlinet_ntoasetclassh_errnoclosesyslogDaemonAddrgetservbynamehtonsreapchildCommandLineArgsntohsrefuseconnectionsdumpstateabortmemsetselectDoQueueRunrunqueueRealHostAddracceptpipeforkintsigproc_list_clearQueueIntvlreaddupInChannelOutChannelDisConnectedinitmapsproc_list_addsetsockoptbindlisten_toupper_tab_atoiinet_addrsm_gethostbynameCurHostAddrSmtpPhaseinet_aton_resMsgBufUseNameServermci_setstatrresvportconnectDialDelaygethostnamegetcanonnamebcmpisattygetpeernameRealUserNamegetsocknamewritestrncasecmpcleanstrcpygetsockoptHasWildcardMXsm_gethostbyaddrdenlstringmap_rewritelink_ntoashouldqueueprintenvflagscheckfdsqueueuprecipientNoConnectcopyheadercopyqueuesetsenderDefaultNotifyopenxscriptdropenvelopeclosexscriptwaitfordisconnectQuickAbortmci_flushmacidcheckfd012linkunlinkSmtpErrorprintopenfdsremotenameFromFlagErrorsgetctladdrcheckcompatstripquotesProgMailerFileMailerprintav__sFmci_getmci_dumpmci_lock_hostmakeconnectionmci_cachemci_unlock_hostmci_scancheckfdopenniceDontInitGroupsinitgroupssetgidendpwentvendor_set_uidseteuidsetuidgetuidchdirdup2_exitHoldErrsDtableSizesetsidUserEnvironexecvesmtpinitmci_dump_allsmtpmailfromsmtprcptsmtprsetsmtpdatamci_store_persistentsmtpquitN_SysExSysExMsgpintvlmacvalueUnixFromLinestrrchrputxlineputlinerewinddefcharsetmime8to7mime7to8fputsOldUmaskumask__lstat13SafeFileEnvRealGidchrootfilechangedfchmodgetmxrrFallBackMXres_searchres_query__dn_skipnamedn_expandTryNullMXList_tolower_tab_res_initres_querydomainDontExpandCnamesgetenvNullAddressputheaderputbodyxputslogsenderStatFilepoststatsemptyaddrreturntosendersavemailPostMasterCopyxunlinkunlockqueueBlankEnvelopeopensetvbufInclMailerudbsenderFullNamesm_getpwnambuildfnameprescanrewritecataddrcopyplistsm_getpwuidTopFrameLogUsrErrsHeldMessageBufOnlyOneErrorvsnprintfHdrInfoUseErrorsToSingleLineFromHeaderNumPrioritiesPrioritiesbitintersectMacroName__mainTermEscapeinit_mdgetdtsizeopenlogtTsetupInitialGidSetgetgroupsopterrgetoptoptargtTflagsetbufMainEnvelopesetdefaultsgetgidRunAsUidgetegidRunAsGidSaveArgvVersionCompileOptionsOsCompileOptionsgetcfnameinitsetproctitleExternalEnvironinit_vendor_macrosmyhostnameunameoptindstrtolQueueLimitIdQueueLimitRecipientQueueLimitSenderconvtimeUserSubmissionxtextoksetoptionvendor_pre_defaultsreadcfvendor_post_defaultsTimeZoneSpecunsetenvtzsetresetlimitsgetauthinfoDontProbeInterfacesload_if_namesHostStatDirSingleThreadDeliveryMeToovendor_daemon_setupSmtpGreetingLocalMailersafedirpathpath_is_dirprintqueuemci_print_persistentmci_traverse_persistentmci_purge_persistentprintrulesMailerprintmailernewenvelopegetrequestsvalidate_connectionsmtpclearenvelopeinitsyscollectsendtoargvgetlasendallputenvstrtorwsetRunAsUserNamesetgroupshelptranslate_dollarsRewriteRulesstabapplycrackaddrinvalidaddrrebuildaliasesswitch_map_finddns_getcanonnameget_columnFatalWritableDirssafefiledbopenaliaswaityp_get_default_domainyp_matchyperr_stringreadaliasesfinduserstrtokprog_openMciCachesmtpprobeIgnoreHostStatusatolftruncateopendirreaddirrewinddirclosedirrmdirMapNLtoCRLFMimeTokenTabftellfseekDefaultCharSetOperatorCharsmacnamesm_strcasecmpdsntoexitstatrenamelogdeliverybitzeropcommaizedoforkclrdaemondrop_privilegesQueueEnvelopeMinQueueAgeWorkQQueueSortOrderForkQueueRunsstrcontainedinMaxQueueRunqsortreallocfgetfoldedfixcrlfsetvendorsetuserenvinithostmapssscanfgetgrnamNextMaileratoboolsetaliasErrMsgFileatooctMatchGecosHelpFileSendMIMEErrorssetdaemonoptionsPrivacyValuesWarn_Q_optionDontPruneRoutesUdbSpecsetdefuserAllowBogusHELOUnsafeGroupWritessameaddrgiveresponsealiasudbexpandmaplocaluserusershellokforwardsetpwentgetpwentchownsafegetgrgidttypathmailfilewritableputfromlineloseqfilesettimeCurSmtpClientsfgetsauth_warningenoughdiskspaceMaxRcptPerMsgbuffer_errorsdoworkstrtoullowerStatsafeopenlseektTvecttTsizeUdbEntsSmtpNeedIntroSmtpReplyBufferstrstrsmtptodsnnmessageendmailerSmtpMsgBuffermallocMetaMacrosmemchrfill_fdhostnamebyanyaddrmkdir_procedure_table_procedure_string_table_procedure_table_size_DYNAMIC_LINK__rld_maplibwrap.so.0_GLOBAL_OFFSET_TABLE__gp_dispdeny_severityallow_severity__DTOR_LIST____CTOR_LIST__libc.so.12__progname__ps_strings_ftext_etext_fdata_gp_edata__bss_start_fbss_endend.text.init.fini.data.rodata.sdata.sbss.bss< D'!'840,($ !!! !@'B$!H"$! /$[9' !$@"!$ 0B$BB$!$" ! `@!$2L @! ` !(! !(\9' ! `!(HƌP ! @T 80,($ @'@܀ 05b' L$t 1$" @! B!@ $$C! $n9' ! B!(!@ 1!@xBB(@$ p$ t$'|  $'t !@$$d'<$0'!X'!!BB0X@! $!0<$䀙 !@n  $考cb$b `!( !0<$䀙 !@2 dB耑1@! 쀙  $ !0@h o`B0j@! 쀙  $ !0@t XdB@$$ ' @(B0@耄쀙  $ !0@t 3@$!0$ $􀙏 (@$  $t ci$ b!0$ $􀙏 !   < $ 老 $ $$!@ $$!@ ! $c!@!` 6@xBB(!@!  `!@ p B$ HB$$ p$  L $| ! !( f.$`B4s9' &! dB@耄쀙  x $ !0@h  `!   $ !   $  B0 @! B!@ $$C$!( $!( $!(@ 'tc?`!xB*C8@!| xƌt*(@! X.1&! !(l xBB(@$ -$!0 xBtc!8$9' $0($ 8'@$<( @(;@!(8@$ (4@ (3@!1$$+(@()@((@!&$$#$!!>( @<(@0(@!9(@$:$$!G( @C( @B( @@( @!$$!$!<'!' 8!@!<!4!HD`0 +s&d7B<B, @$ 1$!(!0`!8 h  ! @!(   !@ a耂BP! @`d7B<B,l@$ 1$h  b$d7B<B,@"2耄쀙  1$!(@h  "2@#$考c0b! @$('耐$(  老0܀  1$!(!0`(!8@  ! @$$  d7B<B, @! 2$h  !H@<840P'9'  H8$!(@l  R$$  T'$P A耂BP  4$@9' !@!  B,@!  D$ ! @!( 䁁" H8$!(l !  X8$ !@! T !@ !  \8$ @! `8$!(  ! T XX0\"` d &h $t   !  $ $dBB, @ 8$h |xtplh'<'!'8!,!0!dB$@<4(B, @ 8$h $@$Ѐ $B$BA!0䃙 ! @!$%$耐 8$ xB @$ 7$ 8$| $!$"!@dBeB, @4$ 'l 4$$ 'l 4$$ 'l B$B@4$$$l  A 9$ c$b$b $l$$$!0 p A ,9$A! $$t 2A!  L9$耐 $ Z B( @R&! L $@ l9$  $@840,(H'9'  ;$!0@h 0''ŒÌČ Ō $$ŒÌČ "B<$C @'$  $1!0䃙 $$F@B$B@4$$$$l  A ;$ d& @eB,$ ;$h eB, @4$$$$'l $Ё 老 1$ 8@"@ $@$!0 $0' !@耑1`́ 耑1B&@"@dB@! 쀙  <$!(@h Ѐ $ (F@( c!CB=@dB@! 쀙  8<$!(@h 1$b4'$( D!DDc$ ( b$ !b(d F2'  h<$AK$$ \8$ @"$T $$ @$ X8$ &@"$ p<$  ;$K$ ;$ K$ ;$!8  K$!(!0!8 !'<|'!'! !0,($ A!  <$""##$ "!  !@ `.$!F&$ !Q7@dĀ  @! .$Ā  @! eF&$ !Q@! .$Ā @! p@.$.$Ā @! &@! .$Ā I@!`! !(@$ ?@!`$ 7&!( <&!0!8 | ! !( t <$Ѐ ! !(@$ @!`$!( <$!8 |  =$!( t !`0($ 8'9' B[$ C䁄C# !@ $0@B,! 4$$9' @&@! B,4B@l$4$(''Ȅ @@)P4 *P0 '$ =$!8B0  =$ 6$* @q$B 4"$2$  @!0{@ s$,%$4 $$!0!@䃙 T@! @('$p C@4$ 9@d B B, @' =$'h '!  !(!0@̄ @ $ !0P !@ # '!Q $@Ā @ ! @́   'b B$ C $b B$ C $b B$ B$ @d BB, @' =$'h ':$Ā  @ B$ BB,@c B!CBB0 @ B$ BB,@ =$$Є @ B$ BB,@c B!CBB0 @ B$ BB,@ b$ c:$`b :$Ā  T@ B$ BB,@c B!CBB0 @ B$ BB,@`.&!  $Ԅ !  !@! 0$䁇#(Q <$ =$* ! @́ 䁇$d B>@! =$h 4!`.$ =$ 4c$b!($',$'؄ @@'$`.&$x$'!C+b@c$bb(@ `$ b! ~!s& !U # !CR$샙  >$! @ b#u^#( =$B*@!BC =$   !b t& cp$7#B샙 :$ ! @#u#(@$B*@!BC >$ &  & !@C& #q!Q b!bd` >$`.B$ #(F$䁂B(@C[$$b`.&!  4!P $<>9'  >$!8@$ #(#(E @`.&!   >$!P $ #(#(E d B @ x=$`.$h `.B$  '<$i'!'<!4!@!8!! `$$HD0,( !@BB0i@d B@F T>$ 0>$!(`h  BCD老"K$􃁏#! `!$c 0;B$bp  \>$!(@t @D !(` x>$ FG V!B0 @! ` ! !(`!0@?!8 ! E5!0@BCd$b[$d B @!(` >$h K$cb! `d & @!(` >$h '$ =$B!8`B4B '܄ƌ$, ;@ @' @7$h '@ D$ ! @' BB0 @! ` ! !(`!0@!8' ! '!0@耂B􃅏 BE @ >$h 􃃏c$bb(@$+bD$)E$$%b$$bD$"E$B@! `!$c 0;B$bp  \>$!(@t K$F$!nC]$Ā !@ d& '!( ! $$]$" !@耄C􃅏c4 DEC!D$D$@C$$䄙 @ D$ ! @ BB0 @! ` ! !(`!0@ !8 ! !0@!8脙 !@! H@<840,(P'9' 0&! $ \?$!8@ ! B3@! ~cPB*C5@q$老 !(d$! `$! ` tb~e䁃cPƌ( B4tb` ?B$hbBg ?$ hc ?B$a<btb@B0&@$bB0!@B,@d& ?$h d&!( d&he&!0$b!8`B4$b hp-!0 @,,c `0b@`0b00B0 @e8 @0(d &B,@ @$h hd$  4@R&.@$! <)58d BB, @!(@ 8@$!0h !tbhp2’B,@ X@$h ! !( B0@$’B,@ d@$h Òb X@$h ! !( 0K@’(B,2@ x@$h ()E! @8 @’(B, @!(@ @$h 0’(B, @0 @$h &0’(B,@!(@ @$h ’(B, @ @$h &B0@d BB,D@ @$h :B#@8B@ B B0@d BB, @ @$h  $0B4d BB, @ $ A$h  $((&@$ !@!8 !0`h&ŒÌČ Ō $$Œ! !( ’ @!8@ (A$e&h d "hd h"ld <5! @!( !0!8l"tc<$h%b$t# ’B,@ dA$h $&!( $#m$ ">c4$#hp! 0R $B4$Id BB, @ A$h (h06v$$0R $B4$Id BB,!@ A$8c$I$w%Cd BB, @ A$h (v$ B B, @ HB$ d BB,M@d$ dB$!(h d BB,<@d$ B$h  B$ef!h hd$  %& B$h h$$ 1  B$h d$e*@b$3! `q$ v$! `$8"!(xb@! `tbB4tb!( ! x"@! t"B4t"!( 1 dЁ @ !@1d f $C$ ! `` d <f 8C$ BB, @ (F$  8F$8 @8$ ((8$ $(pb((,XB$`$(s U @F$8  @ HF$8 @! P @T @!  PF$ .N$!0%(D9' 44@4B @T pF$ N$, @ F$ N$X*| D0 88@X F$  @X F$ B84BF@@4R& F&K$4:$Ā !@ 4 4!b4 F$ 4B$444#".@! @$4!0 $ @4!$!1 @! @&!(42t ((B/@d B@ F$h (!(x (($Db 4@$B0$@!  G$!0@t (( Ub @(BS $(| @K$ $G$!8( $  ,G$!0@ 8G$l 8 @!(@ DG$t ! @8  `G$!(@F0t ! @!88( !@̀ (((耈(􃃏c0Ѥ& (($C B $@@l  G$!0@!8@ +d B @!(  G$!0h 3 $( 쁂B@S쁁14B@( @ G$ F$ (@  " @ G$t   DG$t B4@l  G$!0@ P@P' H$& @ H$  H$8 @'< A$ p  0H$!(@ @(@DB(@ $p D lH$@!(@ $H  H$ D H$ @D d/@Bb) @$ p D H$ p Dc H$@!(@ ,4@H'< A$ p  I$!(@ @ DhH HI$ L TI$ Ё pX$Ё $!( $$@ !@I!# PЀ &$ p  `I$!(@ @ D ,@H L d B@G$ XH$h G$p 8$$@$D $$ $$ $!( hB  '0DԀ A 6 <$C@$XM B0@$$ E (@ B"@B@ B@ D D E  P$B @\ X$\!  A !( I$  <$C@T B0@$  @ B@ Q$T@< !@$C@$X1$B! @ ! @ &A" !(@ I$2!  !  A !(  I$ d BB,@ !@܀  I$!(!0@h P8!x ':$! :$Ā !@! !(@$!8D &d BB, @!(@ J$h x @!! @ A ! ,0@s$H L$ A$ p  $J$L!(@ G$ L :$cbd$ bąB@`B&@$D$ A$ $p  XJ$g!(@ G$ $ A$ p  J$!(@ G$ D @!( A$ $p  J$@!(@ G$ @ ȅB*@! $$!0  Q! $F4 ȅB&*@! ̅ P'Ѕԅ  J$耐  B0 @G$! L @G$ E$  ((8$ ((,$@ u$(Q@ D K$ ((b#@D K$ D ,@G$H L G$,3@L H @K$ ((b$@D DK$ H (D܁ (G$`(C(c4C<$C@,@(C$b(bB4b,@(B@! (!0؅ (bB0bt<$C< C<$C@(bB4b<$CM@(BB0F@ xK$ !@: !  K$  @!  K$ &@ K$ !@ !  K$ $Є @ $ $;$(b B4bd B@ F$h (!(x (C$(b(D((Gb老'􃁏"(B K$(!0 $܅ F$,$@! (!((9' (!0!@ !((!0!@ !((P'(9' ~(!0 g@0'D`!@,$b d #V!CB$B,/@! `!((!8䅙 !@! !(`(!8(l9' ! ( !((9'  Wq1&C"#@R&@4s`@! ( BB0@! (!0腙  !0(' 셙 K$ b4@4B@4BB(@c$bB4bd>B @ L$ 0^`P,d0U@` D$b! K$! (!(`(l9' = 4b̀ DbB$ B0@cb0@<%bb tEB$<bf |E$d$0b(BB0 @<%bf L$ 4s`@( !((9' 0!  ( ,@(@(B@(BB0@! (!0􅙏  $p !8@P D$ #$ DL$'! $ PL$ ! 8 g$!(!0老 < '< '!'8!<!!(L"*D @@J"*@ G$"$B4$CB4 (Œ@<,Œ>@#&<7@b,1@ L!$!""!\@ lL$# tL$ |L$ L$ L$ L$  L$ L$<̀ D@ D$ ! @ H5 @1@-) L$ @'$ L$!8  ' D$ ! @' @D<8H'< '!' !$!(!0,   E L$   E L$ S!$ !0@$ E M$ =F$0:@ E M$ *@K$$& +@&! F$b$ bB B0@ ' (O$$ @>$ -$b.$!C.$ "'!0@ @ $ .$ b< bB$C@.$Ba@$l  0O$!0@ $H 'C$a*b @! @^b$r  '+ @C$a*b @b$d &+@ >$ bDD( $HeC$a*b @! @^b$r & '+@eC$a*b @b$d &+@ > ' beDD( !# $(!&> '! $($$> beDD( ! bDD( & $($ bLB:@*V8@8>eC$a*b@!$C$!$C  beDD(  ! bDF  ! bDD(  beDD( =!C$ a*b @! ^b$q eC$ a*b @! ^b$q &$b B@B0@' '+tK@B!@!` $C$a*b @b$d &+@ '+@ ' $eC$a*b @b$d &+@ '#!  bDD(  beDD(  B@B0@ @O$ J$쁁" b BB0@ ` $ b!(` 4@$ dЁ b B@B0@ $考c b \O$ J$쁁"老 ( $       0 '<'!'!g4܀ d cB,` tO$h !( Ё  O$8 @$!$@  A # QЀ 1&!G$@! @ $`$d $!( $!( $!( ,0 H5$쁁  @K$T 8 !0($ !@! '4  ABg4( B4(I0@$, b8B @04bI$T g4b(老 쁁 B0@$$C#@ @"!X" '!X"c*@ '!(!0 !8@` !@!0#%1&"$%D%($1&dBB,@BB0 @ pQ$!0h c!0"#1& '!(!0 !8@%b` !@V! @w$ $@!0dBB, @!(@ Q$!0`h """+x@$"$("  ! @(T9'  ®@"&!X S"! @'" !@!PB.$X&.$XR&&@R&&#P&+>f@c*@! '!"!p$&*'@!`!P!X"!8P!HX@!@P  0+e @ C *C @ "cb# C B $)%$*@%" "+X@! %%1&*4@%& @!" @$&&1&* @"!Xb$b*@c$&&*"@" dB @" @"N$ƌ" Q$ $" 2B,@2$"N$"$p  Q$!(@ e$:1&! " Q$ ""[$b! ]$Ā !@$&x"' @]$& "$""B$"1$"!0 @:&!  !PC.$b.$B@$" !""!X"&X!##""""""""#'<Μ'!'6B$B,!40@(̀ B06!$"@$6!$"dB B, @!(  R$h 6&"%*@pA<5hƌb, @1&!gBB0@@!FC@ & %HC #b@#P!P!P#P#`#2dB B, @& $R$!(h !4,(8'<͜'!('!!!! @'!0'&$$"(9' @!bB0 @! @ ! `!0@ !8 ! `!(@!0@!8脙 '<˜'!@' dBH!HHHHHHHHHHHHPHXHB, @hH ,R$PH!(h  BB0@l  $ CE$XH@!xH$pH!ƒ @!.$"C&1&"@%! (h9'  !(@pH!@@% B( @pHHH! $  HH!>@ LR$  (@' hRB$(@,@'+.$1&#bc$bB0@<b@<c$bc$b@&$c$bB0@Xb$ &`H#.$b$ $`H(@@(@'('( 'HH@'xHH $hHdBB,#@! $ $ $ R$ R$  R$ R$ lR$!(h  ! $H $!8p  !@=dBB,@者􃆏ƌ R$h  考c=$b$􃃏c b$!XH$􃁏#K$Y# h $$ hH PH$&$dBB, @ . R$h   .@ $,4'  Q01&H$+"!p$! @!(\  !@&dBB,@F$d  R$E0h  F$XH!(1&7!Bd  Q01& !+V@ $('!(xH!0@`  !@!PCER&BD%D%e$!bR&b(@$"ht1& $pib@hH܄B@PH` `H\Z`HtB@R$pH!H@)% B(>@pH R$!(t  BB$@!$ S$H!8  H  D$  H! @  !XH$􃁏#N$k $('!(xH!0@`  A1&h!!P`$ $ $ hHPH $$&@ $`HD$XH"<!@( ' hRB$ <hB@B05@$ xT$8 *@d2BB, @  XU$!(h !(t" 'B4t"$!8  U$!0 !8  t"$$C@t"#q$bd2BB, @!( U$h t%! (80 @t" B06@B0@t"B0+@|"'@d2BB, @$ U$!(h !($'!8 $$$!8  d2&B, @!( U$!0h t"B0B@! @!0 V$%h ! (9' ! d$ ! @ ! q$ ! @ xB B(@$!( @V$| !( d2BB, @!  HV$!(h ! (9' !  $ <& lV$ `,D4@E8  +@)('E$̆  (@('  D$  ! @('  Ć" $XB$0BĆB@@! >! x$Ć!0@<  2! 0! cd$+b!(0B@ 8X$x  @0B! @ X$8  @0BB$0BHB$C<c4(B,D$C! !(0'$І  !@ ! xBB(@! $p  $E @X$!8@|   ! $!0!8@Ԇ  ! $!0!8@Ԇ  ! $!0!8@Ԇ  )'! !(!0 $؆  )@$b!  B BB0 @ \X$  ('<$(!   D$  ! @!(   f$!(@!0@`E<  BS@BB0N@! $!0!8@Ԇ  ! $!0!8@Ԇ  ! $!0!8@Ԇ  @! `X$8  @!&@ ! $܆  dBd-BB,@ dX$h  dDl  |xtplh',@ Y!$!""!\@$H $܅ `dB@G$ T ,B老 @$䆄 |xtp'<$'!'!00B48<,($@ !  Z$c4' e!8(9' 7b(@5b(@4$b! _8$YbBBQ@BD4 6$%b '$ Z$$&  ' D$ ! @ ' &! 1 D$ ! @!( "! ( 9' xBB(@膂B@$B Z$E&| ,B@$䆄 ,$ 0'<'!'! 00c! 8 [$4'4<,($ e!8老 (9' ! !(!0(9' 5$b6b(@4$b48$1bBB)@BD4 &! 1 D$ ! @!( ",$ 0'$b` k%$&!``$&!`@s&&`+ @$X$ $&$&g$&$QBV@R&"$&!@')$&!@'!@$>$&!@$d!B@ H`$h t$  X`$h tB$'p`BC$pa`#ppB*b @ $pXcb$pX" qpX$ p`BC$pa`#ppB*b&@ $pXcb$pX"$qp`BC$pa`#ppB*b @ $pXBC$pX# $ CpX$ e c$h ds& &dc!bp`BB$p`" @ $pXBC$pX# $ CpX$ dB B,@!  Hd$h lb@$ $d !@B,@p`BB$p`" @ $pXBC$pX# $ CpX$ !>p`BC$pa`#ppB*b @ $pXcb$pX" qpX$ p`BC$pa`#ppB*b&@ $pXcb$pX"$qp`BC$pa`#ppB*b @ $pXBC$pX# $ CpX$ e c$h ds& &dc!bp`BB$p`" @ $pXBC$pX# $ CpX$  Xd$ ld$h p  td$!(@h x d$h ! !(!0pX"XB$\"t  d$ 8c$Hc ' H"x#,9' $$ $ C$,$ $,$  $$ $0  d$,"m$",9' &Ć"c0`l dBB,@$B4$CB$C老 c4C,9' !| v$ƌd<  '$  `!@dBB, @ ' d$ 'h  ' D$ ! @ ' w$ƌ!(@<  ' D$ ! @ ' j$ƌ!(@< w$ '  '.$Ā !@Q ( '"@0&!  D$ ! @!( m$ƌ!(@< .$0&! .$Ā %@( ' dBB, @w$ d$ 'h w$ ' 3! .$Ā !@ 0&( ' !A( 'dBB,@ '耄쀙  d$!(@h  '0  'dBB, @!  d$!( h !  D$ ! @!(  !@k$ƌ!( < k$!(  w$!(  f@! S`edBB, @w$ d$h w$es& `C$Ab! C$=bCb7@('!!BD샙 ! g$ d$!8@ dBB, @w$ d$!( h w$!(  C&!B@!! ( b$!(@ƌ!< d/$ @Q$q!  e$8 @! 0i$ e$8 @! $p$ e$8 @! d$ e$8 @!  h$ ,e$8 @$H$"$"@$$1& S@$ "R"S" p$ÈØĈĘ ňŘCC DD E Eq$ b@ pB$" T@ pB$"1&00($ 8'<'!'44hB$!8<,( B0I@ v& @'! 0$ '$ p$!8 ' '! $#(48'􆙏  p$!(!0  xBB( @$% p$!8| ,$ 0'$B! @0'b#(Pb$b#(%b0$b!8$ (! @ (!Bc#Pb@#(00xB$ b@B0xB$! @ g0̅$ (! @ (!B0'#P$(g#("0x$,b,b@! @0xB$0$ (! @ (!B0d&T (!@#P$g#("0x$! @0 $ ($B0 $E0'| ( 0($0'h ('<\'!'B$!,(@ `B@!B!bd!( ,<9' `B&*@,$ 0'<\'!'d8B@!0,$h  !؇B@!,B9'  ''!('d+B!!!!p1@04$h p @0X$h p0`$&h @0d$h $Ĉ"0h$!(  !@@! @!(@ '$ȈІ !@@! !(@'!0$؆ !  D$ ! @!( x0$!(  !@@!0R&1@0R&@! @!(@ '$ȈІ !@|@d+B(B,@!!0$!(`&1&h "@s&&^0$8 @&O@x&I@ '!C*D@@0č$8 @&@,@&(@&""0ȍ$8 @& 0č$8 @&"1&@*0̍'x$0̍%x@'! $0ԍ$$@x!8 ! n$  @ e$ @@'5@'q$  @$! q$ @$! 0䍥$ @! 1@x0$ @5! '! 0$ @*ts&*t@&*t@!"B@! @08$*t@00$0$!0@ 0@R&t⎀<%Ct!@` ! @ !@".@'0D$!(@ $t⎀<%Ct'! !(@!0 $ !@d+B @!(0p$h !pb@b*s&b*@c$b*@0$ t⎀<%Ctp'!HC@0Ď$!(@'–$@B4¦ ! $ ,@! p489' #QH!  ! !(@!0$ d+BcB,@! 0Ȏ$!(h !  B B0@$HH$`b@'d+1&! $0Ў$'@ ! !( "#B, @!(0؎$!(h !(@'!8( "eB, @! 0䎄$!( ! @!0 "eB, @!(0$ p! @!0,_9' $CH@'! $0 $' ! !( d+B#B, @!(0؎$h p!H@–$B0¦! $ ,@! p489' #QH!  ! !(@!0$ d+BcB,@! 0Ȏ$!(h !  B B0@$Hd+BB,@H| $!(0$04$ o@!xs$ @!(5a0Ď$D !(–D'@B4¦!8( d+&eB, @! 0䎄$!( ! D!0 eB, @!(0$ D0<$  @!(0L$ p! D!0,_9' ÖHc0>æ1]@!̈ !@Ï$ @' "! `0`$ @'! `$ !@! `p489' $H@ @!`BB0@&&R&B@B0.@! `+U@!(!0Ј  A0$  bB0 bd+BB,"@0$0B$x0B$0$!(!0h  !0菥$ @!f@'#! $0$ ! !( d+B$B, @!( 0؎$h 0Ď$!( @'–$B0¦! $ @! p489'  QH! !( !  B B04@$2H8 B$!PB"1&=$"1&ĈB@+U@P' $d+B$B, @0$h 0<$!( ! $0`$H'猠$ ! !( 0Ď$!( –! B0¦p!0@49' !@Hb* @s& ! !( !!s&2p8 !$!""!0@"49' !@{u1&B0%b08 c$!pcp!0@#49' !@u1&B0%8 B$!PB"?b08 !$!""1&"1&8 B$!PB"1&=$"l1& $ ! '$B2&!e0b %D0b *@B$ '$P$$CPB2&!e0b %D0b*@BT <%CT ŽB<$C@0R&BC@ '$R&B! ! B00F%b0BC@R&R&d+B$B, @0$h 0ܐ$!( @'! $0$! $猠=$ ! !( 0Ď$!( –!B0¦pH',{9' !@$ $7 $H $HB0>$ !$!""1&"B2$ !$!""1&"1&@.$HA' "$ B$B$ c$cC'@AB ! !( !!!!H$b ŽB B0 @2$>1&"1&0$"1& $ $H $HIb*21&s&Ib*%@Lb*@.$Jb*@PJb*@.$H1& $! !(>  !!.$H!@A'$B0!PB2bB0@>1&B0$ !$!""s&"2$ !$!""1&"1& $ $b* @0HB$!SB&01&s& $B $B=$"1&B0$ !$!""s&"B2$ !$!""1&"1&`p @ @'!( d+BB,@H| $!(0P$h H'$X ,$x 0$$$ >$R&dBeB, @!(08$!0h `!{$!$\$\$brs&\$_$]($)$&X$ 0H$$ J$H&<$D$>$!@BB,@&b!DBB0@c$bB,@c@$(b$ $%x 0\$$ $&xX $$. @$B!BB0@$ $$:X ? $@!t2!dd!Be,@!CQ 420p$!( h $"2.0$@!(B!BB0@0|$$ "2@ "2$@$[3`dB$B,-@s&0$h  p`BB$p`" @ $pXBC$pX# $ CpX$ pzB$+ @0$ #iB( @0$ p %pXa_p R&d& B,@0$h w$l Bwc$ Ib@!` @!0$h !'<'!'ct$hd`\XTPLHD@bdB@0($h l - @0H$ :N$!@@%*@0p$2$%@$P!""@ '8'@C$bdB B,@0$h l  '%e)"@0$ dB@0䕄$h l `dB#B,'@0$h ! @ 0$h !  0$h @ $Cb$hB~C$b,@0X!$!""!\@q '!0$49' E!  0@s&dB$B,@0$h ! @ 0$h !  0$h dB$B,@0$h h &E!  f@s&Y &b&D dcc,`!@D܈ 0 $ !0 0<$!(@h . "*@d- ! e!0@Є @d !""@s&\&! @!(  @s&Q&&&G &8&+X@ '&dB$B,ю'@&0D$h ! @ 0$h !  0$h  Cpb$B,@$h&+@&8+@q @8+@@dB B, @0P$h %dB B,@0d$h ! l D$ $&%&@'C$jbF8@!FB$!+(@+5 @0x$ N$dBB,7@!(0$h 0"+P!@0$h pX$Ё 0$h "&+P@0$h 0"+PK@+h@&b"+P@s&=&+h @$0Ė$ A$b(rD bdBB,@D܈ f0䖄$!(@0<$h b@s&&R@`s&@''0C$h$bh 0&$$&! $!0 !@ !(0$ &!'!';@(R/ViB&B,@&&&! !(!0 08'&#849' &!  B$!"!$H$H!!@@&! !(!0 08'&#849' &!  '#0d0$0 !( '!0($49' ! !(''4\9' !@ ! !(!0$49' ! ("@! !('$4ܖ9' !@A$' @ D$ ! @ bs&+h@&@ 'b@s&+h@&b@s&&@'49' `! @K$@'b@s&'#0d00 dBB,@0($h l ct$bdB@08$h l hd\XTPLHD@p'<'!'\!T!X!D!d`PLH@"@!'0&"C$b!(!0< !@ A0$ uN$dBB, @!0@0ė$h  @$#&d&bc$$b@$!S@! `!(!049' !@K$b'!`'!(@!0!84t9' !@K$b!`@'c$b@c$c$#s#7!bc( `0ܗ$ A$ @!(! `! $$b@c$!Q@1&"r@&!d\XTPLHD@h'<'!x'|l!h!t!xp d$b!d<B @!00$%h K$! !# b0@<$b@! ` d<R&B @!00 $%h  $&!( "!0`B '!@ C`!@@!(@0D$ 08$h  K$F!@"<$CA@!@d<B @!00P$%耇h *@!@! $p ('! @$'0x$ !  D$ ! @!( !@|xtplh'<'!'dB<!H!T!P!\XLD@B,@80$!(h ! l  ! P$ !@! P$ c%C"@C$*b0$ zc$B4bo@!0@@B"b2@ B0@! @0&! @X !@! @!(('$4ܖ9' !@ ! !@$!0!84t9' !@K$bb2î3@b2d/@b2"@! 0$8 @&@@b2dbc$@&! $!0!84t9' !@K$bb2î@! $$!0!84t9' !@K$bî! !(!0!84t9' !@K$b! î! $!0!84t9' !@K$bî! !( '$49' g$ '!0< b2 @@$ b! 0$! |$$!8D g$!(!0< d B @0$|$h |B$  '$4!@N!  u)b(@nt! s$$@$:!%r=b(@y x! J-k%$@$$$"@)%!@`!  ! !(!0@!8脙 D<840,(H'`K$bx'쁁3x'"! 4  `!`,B@!`䆄$  hd\XTPLHD@p'<'!'d !t !| x p l h ` \ X b@!tbB0@! `$! `t$4/9' '! !(@ q !! !!ƌ $ !@.! 考c$wbxBO@B2L@܀ 耄!@쀙 $0P$e!8| .!(!0$􀙏 F@xB@! B2@耄쀙 $0x$e!8| !  A!@B&C@# B$T$! `4/9' '!(@舙 R&Ѐ R&B*y@!  ! 0$ !@ $H ܀ 0$'!0@ d(B@0$0$e0̝$h d(&B,@0$h ! `􄙏  B,@0$h hd$  B,/@0$h $$!0 0$h b @$0$$h D!0 tb <$Cq@! ! `d$4/9' '! !(@ ! ƌ$ !@ !! 0$ !@@! ܀ 0,$!(!0@ ! ' @$bb'! 8$tb <%Ctb ! hB!(`b!0!@ ! @f0`$ b! 0l$$ ! f0t$ ! f0|$ ! f0$ ! f0$ c$ b! fg0$ d$!0䄙 ! 0$!0@ d$!0䄙 ! 0$!0@ tbB0@'w$'tbB0@r$$tb<$C@8$$tb@B0@b$$tb<$C@d$$tbB0@n$$ @! 0$' r$!(` ! @$!0䄙 ! 0$!0@ s$!(` ! @$!0䄙 ! 0$!0@ _$!(` ! @$!0䄙 ! 0Ȟ$!0@  b BB0@$`dd!0䄙 ! 0О$!0@ d$!0䄙 ! 0؞$!0@ ! !(49' hp8 '0R&#b0@b0*@$e0$| ! !( 49' 8$!0䄙 ! 0$!0@ "C$a#"*b@R$"C$#R$C!(  B0@"C$a#"*b@P$"C$#P$C!(  B0@"C$a#"*b@N$"C$#N$C!(  B0@"C$a#"*b@S$"C$#S$C!(   B0@"C$a#"*b@F$"C$#F$C!(  @B0@"C$a#"*b@D$"C$#D$C!(  "C$a#"*b@:$"C$#:$C!(  $!0䄙 ! 0$!0@ ! @ bt xB B( @!(!0@!8숙  `d(B@0$h ! !( ( '`$ '8$$\^`b0(B$d g$0,$!0` '< r@! ?$ $D@ Cb0@b0tbB0@b0 @'$!8`D @! 00$ D& Z@ B0B0U@"C$a#"*b@?$#b$"t!(  !B!RB2bB0@"C$ a#"*b @! U!( #b$"p!(  &*@B"C$a#"*b@?$#b$"t!(   Cb0@'!(b0@!(tc B B0@f0!0! @E'􈙏 0D$䄙 ! 04$F!8@ R>@! 0<$ ! Ё @ԁB @$؁ @ "@B0@0d$'0@$ 3'! `q$4/9' !@'! !(@舙 A܀ 0$!(!0@!8@ d f0$ qtbxc老 B4Pc( `tb$e0$!8@| d(B @e0ȟ$h | t p l h d ` \ X  '<8'!' !,!840($,@`!  }B$B @ `! `0蟥$  }!$ $}!$i X @!!!Q QRT }$,$}B$B B8 A@$}!$2 }!$0@! ` " @! ! `0쟥$ $!0䄙 ! `0$!0@!8@ $!0䄙 ! `0$!0@ 80,($ @'<'!' ,!4!0@<8(, 0  d"̀  !@8!(  ,@!0& `!(00$t  xB B( @$08$0<$!8|  ] !LW Ltc`xB*C @4P$!0  5! $`  $   !@$E耄쀙  0L1& `!@0p$!( !0t  xB B(@$08$0|$!8 |  L !04P$  $t  !)$`  ! h  $t  $t  L!04P$  $H  $t  $!(  $D  0$l  xBFB(@l  $08$0$|    ܀  @!  !($  tc!@ tc$!(`(  , ! !(`d  B @$B@$B@$" ! 4p9'  c`!@  ` "̀  B$*@0  d"̀  !@8!(  '@8B0Ƞ& @!(0$t  xB B(@$08$0<$!8|  `  Y@R&8B @0$t  B1@8B @!0@0$!8 $t  xB B(z@$08$dB04$$|  d`8BA@!0@0p$!8 $t  48B@!00$t  0$!0@!8 $t  !0!8`$49'  老 @! @$  4  4  ! 4  B@`  $@840,(H'<'!$,"<Л'!'d)BL$`\XTPHD@<87@(0$h  0$h  0С$h  0衄$h  1 0$ 04 $4 ! 4 ! 0$ !@$0$ ! $!  !@ ! d)B2B, @%&0($h #qf$b! 0&!  B,@! !( @! c&*@`! xB@$08$0@$| ! \B$B*@0&49' \B$B*@! 0&! 0`$ !@!`! d)BB,@耄쀙 0d$!(!0@h 老 g&$#UXc$c!b D$ ! @!( !0" d%$􀙏 "<"B"@"/$b&! !($89' !@S$C<0@0 @! %0$ !  D$ ! @!( D" @! %0$ ! 4i9' 8"!  H"! | AL"L ! | 6" @! %04$ !  D$ ! @!( vP" @! %0X$ !  D$ ! @!( T\"!  D$ ! @!( "! @/$Ā !@&@!"B@0`B$" 0! /$Ā !@&@! "@B@0pB$ "0@0xB$"0B,j@B!bBB0`@,`!B.!BB0 @0$Ā @&@0B,@ c!CBB0 @&b0B,@@&B @! @%0$ ! @Ȇ !@ `!(@0$ -bT" b'X"!  '!0  T"b0B,@!DBB0@&b0B,@@&b0B,@!DBB0@&b0B,@Ib0B,>@! !BB03@!!DBB0@&b0B,@B @! @%0ȯ$ ! @@  @!(@0䯄$  B X"! !(!0 X">@8" @%0$ " @%0,$ DBB( @$0H$ "B0@L"@$L"4BB(@<"%C"$0l$8  @$0t$8 @"@0`B$" "@0pB$ ""@0xB$"D".@$8%@$u$ @g$F@@$@@0|B$D"0B$D"$$$ !@ D44 %0$ DB!@&D" Q!"140'<6'!'!H@~$,($ ?@!@$f$b$n$r$ $ $ $ $\ $" $+1@ q!Hgb(@ p y xK!@  $J-F$$@+@~B$($ 0'<4'!'!!MO@&*!b0B,@&&B !`!`@&&B!bBB0@& &c!CBB0 @! @&b0B,@! @ D$ ! @!(@ 1&'!db@("*'!P@1&!  ! !@!(!0  !'<2'!' !P($".@!(@0ܰ$h 0"0$h l 0$h l R& B*@1&( 0'<1'!'0<!HD@8>"4%<"B"@"H" T"0$$X"!(&' $h 0B!QB2bB0'@p`BC$p a`#ppB*b@!  RpXcb$pX" ppX$ 0&*@BL%08$h 0D$ 0\% 0D$h 0%0X$ &0X$'0X$0L$h 08"%@!@0d$h 0@8" 0h$h 0& 0@0$h 0H@<8P'<.'! '!! $X老 !! @=$Ā !@ 1&! @ !B1&"V $1&"C1&1&1&# $b $ 1&"C 2=$0\$  M!#b $ 1&# b! @ $1&"C1&1&! @.$Ā !@&s&b(@!! @ d!(@!0@Є @d ! @!@  !` s&b@! @b@!b @!(@0x$ <  !(@0$g . ! @ d!@ !(@0ж$f8$8"t 80v! s&b @!bV! s&b@d%B+@.0$@B!BB0@0$e0($!804$!0h ! @ XB<@!$!""2bB0@d%B@08$h +HB@$"b@M$BB$B,@d%B @$0D$h $ d%B @20$h 2C$gb,=@0 !$!""!\@! @H F"Cp$bqb(@m$b$s$ b$3"$."*"E0P$ @$T B @! @0h$L  L B@! @,$Ȁ"m$ Ȁ"B,"@ $,"! @/$Ā !@ $& "! @ p"! @H "! @| L"Cd$beb(@ `b$ bi$bq$b i$§B§E0p$ @$T ! @H ؀}"By@! @ D$ ! @!(@ Pb"BB$b,Z@0!$!""!\@BK§! @T B0@"! @H 5"! @H X*"Cb0B,@c!CBB0 @! @| \"$\"! @@  @!(0$!0@ B\"B@! @0B$\" D$ ! @!(@ \"! @| P"!@"#{@& $C1&"C1&1&#j`-$b!$+$b1&1&#! #`!`@1&1&B!bBB0@1&1&"@! @ 1&! @0$ @b.܄3"&@! @ @&@ @0̷$!(@ `'$b%C"#@dBB,A@܄ƌ0$h 1! @H &"! @H `"! @ D$ ! @!(@ @"! @| `A"` ! @m$ T"! @H "! @| xc*b`! @| x"! @P'4 P!@ D$ P! @  !@! !( $Ԅ ! ƌ!( X< ! @H ܇"! @H  |"! @d t! @H  @$ctbB4ctbBtC$dZtC!@#b0B,@!DBB0@1&#b0B,@"#H@b0B,@! !DBB0@1&#b0B,@"@ 1&h@! @ @&@ @0$!(@ hB%Ch"X! @ D$ ! @!(@ "! @| D"B@! @0@B$ D$ ! @!(@ "HB@$l"! @H p"O! ! @8@9' B@! @0HB$" D$ ! @!(@ o"! @H ԁd"! @/$Ā !@ %& 0T$89' 0`$!(@89' C! @ D$ ! @!(@ +"! @ D$ ! @!(@ t"!@"#@b$:$B,@D 1&1&"#@b$Cb0B,@c!CBB0 @! @| X "$X"! @Ȇ !@ `!(@0l$  b cX"\#X <0$4 x "@! B@! @ D$ ! @!(@ P"! @H +8"! @H dz"! @| 0o"! @| 4d"! @| 8Y"! @H N"! @| <C"! @| @8"BB$-b,@0!$!""!\@$"" $"0̸$!(@! @ D$ ! @!(@ t"! @m$ "! @$$䄙 ! @ D$ ! @$$!@䄙 ! !(@ Ԉ"! @ D$ ! @!(@ l"! @s$ "! @0츥$ @! @ 0$ @! @$"0$ @! @$v"0$ @! @$g"0$ @!(@$X"0,$ N! @ D$ ! @!(@ 86"! @ +"! @H  "! @ "! @| t "! @H t"0L$ ! @ (B,@'! !(@ !  D$ ! @!( |"! @!(!04$h9' ! @ D$ ! @!(!0!@4$h9' ! !(@ 䇁"! @!(!04$h9' ! @ D$ ! @!(!0!@4$h9' ! !(@ w"! @!(!04$h9' ! @ D$ ! @!(!0!@4$h9' ! !(@ ؈L"! @H A"! @H 6"! @H |+"! @| h "! @H "B@! @ D$ ! @!(@ "0X$ B@! @ D$ ! @!(@ ԇ"! @H ؇"!@"#@b$:$B,@D 1&1&"#@b$Cb0B,@c!CBB0@TBF@! @| T<"! @Ȇ !@ !(@0$ )TB#@"@! @ D$ ! @!(@ @" T"\##W`!`@! B!bBB0@\BE@| \;"@ !@ `!( 0$ )\B#@b\"d%B@.0$@!(B!BB0@0乄$h X B!<@B$ ! 2$%b'<'!'d%B!!$B,@ ܈ 0ļ$!(@!0 h ! $$ B! ! 2$ %b $('<'!' !40,($b0B,@!DBB0@&b0B,@b0B,@!DBB0 @!0ؼ$ !_$.$&b0B, @!DBB0@&&F&&E&@&&b0B,@!DBB0@&b0B,@b0B,@!DBB0 @!0$!(` !&b0B,@!DBB0@&b0B,@@&b0B,@! !DBB0@&b0B,@! $!0 !@ @! `0($!(`!0  h!$$ ! `!@ B& " D$ ! @!(`  $&"B!(!@ @"B4"d%BB,6@ "&" &"@0xB$%ƌ'0P$h 0%0x$4&0x$8'0x$0$h  "&4,($ 8'<'!'(!<!HD@840,b0B,@!!DBB0@&b0B,@b0B,@0$G!(!dBB0@! !( $ !8@d,@!0$!(d$ $`!_$!dBB0@e&@!@a pbc!CBB0@0$!(` $c!CBB0 @&b0B,@ ! ! ` $!0  !@$$H=$F"&b0B,@!DBB0@&b0B,@c!CBB0 @! 0ؽ$!(` 7$!( $ !8@d,,@!(0$!0`d$  $ @!8@B$BB$!8@d(!$' @!(`08$d$ $ ! !(`0`$  !! !H@<840,(P'<'!'d%B!,($ B,@ !( 0$0$h  ,$ &X$"$""""$4"d%B,$#(# #$#x$,#0#<$8#B,@0$h 0$h 0Ⱦ$h (0ܾ$h 0쾄$h 0$h  0 $h 0 $h 04$h $0H$h ,0X$h 0h$h 00$h 40$h 80$h eR&#b0B,@!DBB0@1&#b0B,@"G@! S&@@&#b0B,@c!CBB0@! m$ BBB BBB! :$Ā  @! =$Ā  @@! E$89' !,$ 0'<<'!'d%B!$!,( B, @0$!(!0`h ! `m$ !@! .$Ā !@@! @R&0п$ @! 10ؿ$ @! 10࿥$ @! u10迥$ @! g 10$ @! Y10$ @! K10 $ @! =10$ @! /$10$ @! !(10$$ @! ,10,$ @! 0104$ @! 410<$ @! 810H$ @!  10P$ @! 10T$ N@! ! `h$  @!@! @0\$8  @! @\1`1d10`$ @! @\10h$ @! @`10p$ @{d10|$q!(@0`$ N@! ! `d$  @!@! @0\$8  @! @<1@1ND10`$ @! @@<10h$ @! @2@10p$ @$D10$!(@0$  @!(! `m$  "0$ ,$ 0'<'!'`H!plhd\XTPL08 Ȏ! @0$ /!dB@!(0($h ! `!( %`! ,$Ā @! ;$Ā @! <$Ā  @! ($Ā @tŽ$$Ct®tŽB0@ $`!,$!!  D$,@! ' !@! !($䄙 ! !(@ @!Cb0B,@!DBB0@,$H!(R&! @0$!8(' !@((~`,! `!( @! dBB,@0@$h ! `!( bB4b! !(89' !@< "B4"dBB,@0@$h ! !(  dBB,@0X$h ! !( B4#@B0%b#$@<$b$<B4$bbB0%b8b8!BV@! !808(8д9' &@ ' Ȯ! 4 !pld`\XTPLHx'@!xB B(0@$p  !8@PB0@0XB$0`B$ 0hB$0pB$, $00$|  "B4"!'#$@$0|ȵ&"$ ($C"! ($  @!  $Ā  c! @c$#R! @$#$Ā  ! @-T$$R$$b0B,@$$!EBB0@$$ @!@`$$!EBB0@$$@! , 0ȥ$ ! 0ȥ$!0t  'xB B(@$! p  , $%0$|  ', ( '%8`9'  h!"( B@B0@dBB,@耄쀙  0Ȅ$!(@h  $ B0@dBB,@0Ȅ$h  !(  "B4"(0(ȥ$  ) (, !`     '<`'!'<`$$  '<'!' !$!, (!(h&&!88`9' &,$ 0'<'!,B0@!$0@B$Vib,<@0!$!""!\@0HB$E0PB$@0XB$;0`B$60pB$10hB$,0xB$'0B$"0B$0B$Q<B4(C# b$$0B$ 0B$0B$< q'!'D!H!\XTPL@<80lє&!!`"%@!+$\$($$^B,@  ! Ā @R&1&"%@&@&^!`@0B$B!*P@,$4 !  ,!$"0!$0,1&1be-@+$\$($!&^B,@s&  ! Ā @20$gb!! `:$Ā !@! `@$ U@! @S+R@!$!  !@. @'E!d&E& <$!(  '!P@@$''!0'L @! `T,$@ !@U&!  B, @'!(  T!T!@'!'$b)' b BB0@0' <$C@@$0'0P$!(!0@!8 09'  C:$,$0d$!(!0@0' 09'  0|B$BeƌG0$"l  ! !(@!0` t9'  ! @ $! @K$0`$耂B!8 B$! @K$0h$  ! !(@!0` 9'  K$Q<B B0@Qbb&%$!&$7w+ @!(`! @0L$!8 *v#(! #(e0L$!8 xc@!CB!  !&1&#$`,$b;$bLD@<840,(P'$b$>$h ,+C$a*b@>$b$>$h%&C$a*b @b$d +@%C$a*b@!$C$!$C  "%DD( %C$a*b@ $C$ $C B4@+ @!C$a*b @b$d &+@l 0$!0@  $L@$8V6`< "B$C/@%C$a*b@.$b$v +C$a*bT@.$b$vF$b`+1@! 0$$ w@+ "B B0p@+%C$a*b@>$b$>$h Q+C$a*b@>$b$>$?h 9+C$a*b @b$d %C$a*b @b$d &+@B$@b$u $  "%DD( +K@EU+& $?b $=b<`+17@+%C$a*b@ $C$ $C +C$a*b@ $C$ $C +@! HD<840,($ P'<'!'xB !(cB(@$$B0$E!8| ! @ AxBbB(@$c耂B0$e!8| ( 0'<'!'!!$d5s&,( bcB, @!0$!(!0 !8@h $ b! 0$!( !0@ ! ܁ AbcB,@耄쀙 0$!(@h ,$ 0'<0'!'D!TPLH@ (08!8Z`<`$ F@!0xBB(@B00$h$E0$| h 老 ` 9' B@!l 08$!0@ !8 t$ !@0 b`B0"@!$$ (0老  !@! 耂B S0 b$R b b`B0@! ́ BB$" `Ba@!l 0L$!0@ M!B@l 0\$ !0@ B@ b &@B0&@$"B@ b @B0@&@B0 TLHD@X'<̴'!'<`$$  '<|'!'0!(!,!! $4$< $@8$B$ A!  !@b$qp7 $"B$ A!  !@b$q >7! !((  $R&$@#B*@@R&! @ d9' ! !@!(`#!0 !p! 4 !`##B>&BB$c$" a!  !@b$q7! !((  $" $}" $!b&!@<40,($ H'<'!''$ P $(' %salias: QDONTSEND owner-owner,:/|"Message delivered to mailing list %s aliasespostmastersetalias(%s) Too many alias databases defined, %d maxaliases.files sequencesetalias: cannot create aliases.files mapAlias%d ,/:implicit map %s:%s %s setalias: unknown alias class %ssetalias: map class %s can't handle aliasesaliaswait(%s:%s) @aliaswait: sleeping for %d seconds aliaswait: not rebuildable aliaswait: no source file %s%sauto-rebuilding alias database %s*~*alias database %s out of dateWarning: alias database %s out of dateCan't open %s: %s newaliases: cannot open %s: %swarning: cannot lock %s: %sAlias file %s is locked (maybe being rebuilt)rebuildaliases1alias database %s %srebuilt by %sautoCan't create database for %s: %s Cannot create database for alias file %srebuildaliases2554 alias line too long554 Non-continuation line starts with space554 missing colon554 %.40s... illegal alias name553 %s... bad address554 alias too long554 %s... cannot alias non-local names%s: %d aliases, longest %d bytes, %d bytes totalforward(%s) 554 forward: no home/no/such/directoryz/.forwardforward: trying %s forward: transient error on %s forward %s: transient error: %stransient .forward open error: message queued554 setevent: intvl=%ld setevent: intvl=%ld, for=%ld, func=%lx, arg=%d, ev=%lx clrevent: ev=%lx tick: now=%ld tick: ev=%lx, func=%lx, arg=%d, pid=%d wCannot create %s354 Enter mail, end with "." on a line by itselfcollect timeout waiting for input from %s during message collect451 timeout waiting for input during message collecttop, istate=%d, mstate=%d %05d <<< [EOF] istate=%d, c=%c (0x%x) nextstate, istate=%d, mstate=%d, line = "%s" From EOH collect: premature EOM: %s collect: premature EOM: %slocalhostunexpected closeI/O errorread timeoutcollect: %s on connection from %.100s, sender=%s: %s451 collect: %s on connection from %s, from=%sNo recipient addresses found in headertoccapparently-tobccApparently-ToToBcc undisclosed-recipients:;Adding %s: %s 5.2.3552 Message exceeds maximum fixed size (%ld)message size (%ld) exceeds maximum (%ld)5.6.1554 Eight bit data not allowed8BITMIME7BITrCannot reopen %s *** Mail could not be accepted *** Mail of at least %qd bytes could not be accepted *** Mail of at least %ld bytes could not be accepted *** at %s due to lack of disk space for temp file. *** Currently, %ld kilobytes are available for mail temp files. 4.3.1452 Out of disk space for temp filecollect: Cannot write tf%s/dev/nullSatFriThuWedTueMonSunDecNovOctSepAugJulJunMayAprMarFebJaneatfrom(%s) subjectcontent-lengthcontent-typecontent-transfer-encodingreturn-pathcommentsmail-fromviax400-receivedreceivedresent-datedatetextmessageresent-message-idmessage-idapparently-toresent-bccbccresent-ccccresent-totoreturn-receipt-tofull-nameerrors-toreply-tofromsenderresent-reply-toresent-fromresent-sendergoawaynoreceiptsauthwarningsrestrictqrunrestrictmailqnovrfynoexpnneedvrfyheloneedexpnheloneedmailhelopublic/etc/service.switch/etc/hosts/var/run/sendmail.pid@,;:\()[].'postmaster%s%sdead.letter/var/tmp//%snobodyprog, P=/bin/sh, F=lsoDq9, T=DNS/RFC822/X-Unix, A=sh -c u*file*, P=[FILE], F=lsDFMPEouq9, T=DNS/RFC822/X-Unix, A=FILE u*include*, P=/dev/null, F=su, A=INCLUDE uhash.dbbtreenisbestmxhoststabimplicituserdequoteuserdbprogramsequenceswitchnullhost host -a.aliasesfilesaliases.filesaliases.files nullaliases.nisaliases.nis nis -d mail.aliasesaliases switch aliasesr# hostsdns554 Who are you?checkcompat(to=%s, from=%s) getla: getloadavg failed:getla: %d ??shouldqueue: CurrentLA=%d, pri=%ld: FALSE (CurrentLA < QueueLA) %s (by calculation) TRUEFALSEdeferring connections on port %d: %d per second*~*rejecting connections on port %d: load average: %drejecting connections on port %d: min free: %drejecting connections on port %d: %d children, max %dreapchild: waitpid loop: pid=%d, status=%x**end of format**???????4@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@6@p6@p6@p6@p6@$5@p6@p6@4@L5@p6@4@4@4@4@4@4@4@4@4@4@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@|5@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@l5@p6@p6@p6@p6@p6@\5@p6@p6@5@p6@p6@p6@p6@p6@p6@p6@p6@p6@p6@46@|5@p6@p6@p6@p6@p6@p6@p6@T5@D6@p6@l5@p6@p6@p6@5@p6@\5@p6@p6@5@0123456789ABCDEF0123456789abcdef/SENDMAIL/ANY/SHELL/enoughdiskspace: no threshold enoughdiskspace: bavail=%ld, need=%ld low on space (have %ld, %s needs %ld in %s)SMTP-DAEMONenoughdiskspace failure: min=%ld, need=%ld: %s lockfile(%s%s, type=%o): SUCCESS (%s) cannot flock(%s%s, fd=%d, type=%o, omode=%o, euid=%d)FAIL /etc/sendmail.cfBerkeleyvalidate_connection(%s, %s) check_relay ... validate_connection: BAD (rscheck) sendmailunknown ... validate_connection: BAD (tcpwrappers) tcpwrappers (%s, %s) rejection ... validate_connection: OK gethostbyname(%s)... failure %s SIOGIFCONF failed: %s scanning for interface specific names, ifc_len=%d flags: %x WARNING: interface %s is UP with %s address[%.*s] a.k.a.: %s gethostbyaddr(%.100s) failed: %d NOQUEUE%s: %s%s[%d]: %s ...%s[%d]: log terminated, too many parts%s[%d]: %sXDEBUGUSERDBTCPWRAPPERSSMTPSCANFQUEUENISNEWDBNETUNIXNETISONETINETNAMED_BINDMIME8TO7MIME7TO8MATCHGECOSLOGUSESETEUIDSAFENFSPATHCONFLOCK_ON_OPENIP_SRCROUTEIDENTPROTOHASWAITPIDHASUNSETENVHASUNAMEHASSTRERRORHAS_ST_GENHASSNPRINTFHASSETVBUFHASSETSIDHASSETRLIMITHASSETREUIDHASLSTATHASINITGROUPSHASGETUSERSHELLHASGETDTABLESIZEHASFLOCKHASFCHMODwdhmsInvalid time unit `%c'X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@X@zero seconds%d+%02d:%02d:%02d, %d week%ss, %d day%s, %d hour%s, %d minute%s, %d second%ssmtptcp554 service "smtp" unknowngetrequests: port 0x%x *~*unable to write %s%ld %s jgetrequests: %d daemon lost $jdaemon process doesn't have $j in $=w; see syslogdaemon $j lost dotdaemon process $j lost dot; see syslogaccepting connections on port %dgetrequests: acceptgetrequests: forking (fd = %d) daemon: cannot forkstartup with %srwcannot open SMTP server channel, fd=%dgetreq: returning opendaemonsocket() opendaemonsocket: can't create server SMTP socketproblem creating SMTP socketopendaemonsocket: setsockopt(SO_RCVBUF)opendaemonsocket: cannot bindopendaemonsocket: cannot listen!opendaemonsocket: server SMTP socket wedged: exitinginetiso554 Unknown address family %s in Family=option554 host "%s" unknown554 Address= option unsupported for family %d554 service "%s" unknown554 Port= option unsupported for family %d554 DaemonPortOptions parameter "%s" unknown,s@v@v@v@v@ CACHE %s NULL851 %s: Name server timeouthost_map_lookup(%s): bogus NULL cache entry, errno = %d, h_errno = %dhost_map_lookup(%s) => DEFERRED host_map_lookup(%s) => FAIL (%d) NULLADDR0[UNIX: %.64s][UNIX: localhost][LINK: %s]Family %d: %02x:[%.200s] ===== SENDALL: mode %c, id %s, e_from e_flags = sendqueue: 554 Too many hops %d (%d max): from %s via %s, to %slocalhost5.4.6sendall: QDONTSEND After first owner pass, sendq = owner = "%s", otherowners = %d Checking ... QDONTSEND ... First owner = "%s" ... Same owner = "%s" ... Another owner "%s" ... Null owner ... QBADADDR|QQUEUEUP ... expensive ... deliverable sendall: split %s into %s, owner = "%s", otherowners = %d sendall(split): QDONTSEND ... stripping %s from original envelope ... dropping %s from cloned envelope ... moving %s to cloned envelope clone %s, owner=%ssendall(owner): QDONTSEND No deliveries: auto-queuing after envelope splittingsendall: final mode = %c ================ Final Send Queue(s) ===================== *** Envelope %s, e_from=%s *** ========================================================== sendenvelope lockfpsendenvelope dfpsendenvelope(%s) e_flags=0x%lx [NOQUEUE]sendenvelope, flags=0x%x{envid}{bodytype}sendall(%.*s)deliverable: mailer %s, host %s, user %sdeliverable: mailer %s, user %send of sendenvelope%ssendall: link(%s, %s)!sendall: unlink(%s): permanent!sendall: link(%s, %s): permanent --deliver, id=%s, mailer=%s, host=`%s', first user=`%s' remotename: huge return %s-f-r554 Too many parameters to %s before $u send to ctladdr=deliver: QDONTSEND 5.2.3552 Message is too large; %ld bytes maxcheck_compat[FILE]2.1.5%s... Successfully delivered ,554 deliver: pv overflow after $u for %sopenmailer:%s... openmailer(%s)554 Cannot send 8-bit data to 7-bit destination5.6.3before delivery[LPC][IPC][TCP]null host name for %s mailernull host signature for %s554 non-clever IPCtcpService %s unknowndeliver: null host name in signatureopenmailer: Using cached %sSMTP connection to %s via %s...E4.4.5%s %s: %suser openConnecting to %s via %s...Connecting to %s port %d via %s...%05d === CONNECT %s openmailer: makeconnection => stat=%d, errno=%d deliver: no host nameConnecting to %s...%05d === EXEC %s before creating mail pipe%s... openmailer(%s): pipe (to mailer)openmailer: NULL %s... openmailer(%s): bogus mpvect %d %dmpvect[0]mpvect[1]%s... openmailer(%s): overlapping mpvect %d %d%s... openmailer(%s): overlapping mpvect %d %d, lockfp = %d%s... openmailer(%s): pipe (from mailer)rpvect[0]rpvect[1]%s... openmailer(%s): cannot forkopenmailer: setgid(%ld) failedopenmailer: seteuid(%ld) failedopenmailer: setuid(%ld) failedopenmailer: running as r/euid=%d/%d openmailer: trydir %s %s... openmailer(%s): cannot dup pipe %d for stdout%s... openmailer(%s): cannot dup xscript %d for stdout%s... openmailer(%s): cannot dup stdout for stderr%s... openmailer(%s): cannot dup pipe %d for stdinCannot exec %swdeliver: cannot create mailer output channel, fd=%drdeliver: cannot create mailer input channel, fd=%dContent-Transfer-Encodingquoted-printablebase64Content-Typetext/plain554 deliver: mci=%lx rcode=%d errno=%d state=%d sig=%safter delivery%s... relayed; expect no further notifications NO-TO-LIST%s... end of deliver(%s)5.5.45.5.25.1.15.1.25.3.05.5.04.5.04.2.0UNIX%d@,@h@@@T@|@|@@|@h@@@|@h@|@mci_inmci_outendmailer %s: wait451 mailer %s died with signal %oArguments:giveresponse: null envelope250 Sent%s (%s)554 unknown mailer error %d: %s%s: %s%s %.3s %%sgiveresponse: stat=%d, e->e_message=%s , ctladdr=%s (%d/%d), delay=%s, xdelay=%s, mailer=%s, relay=%s [%s]queued..., stat=to=%.*s [more]%sto=%s%sgkFrom %.800s d remote from %.100s putbody: Cannot open %s for %s from %s<<< No Message Collected >>>MIME-VersionMIME-Version: 1.0Content-Type: text/plain; charset=%sFrom %05d >>> !%sputbody: df%s: read errorputbody: write errormailfile %s ctladdr=/dev/nullmailfile: Cannot open %s for %s from %smailfile: Cannot chroot(%s)/mailfile: cannot chdir(/)mailfile: setgid(%ld) failedmailfile: setuid(%ld) failed554 cannot open: %s554 file changed after open554 cannot fstat %s451 I/O error: %smailfilechild died on signal %dhostsignature(%s) = %s getmxrr(%s, droplocalhost=%d) getmxrr: res_search(%s) failed (errno=%d, h_errno=%d) getmxrr: res_search (%s) failed with impossible h_errno (%d) unexpected answer type %d, size %d found localhost (%s) in MX list, pref=%d MX list for %s points back to %sHost name %s too long%s(A0)A(A(AL.A(Amxrand(%s) = %d dns_getcanonname(%s, trymx=%d) loop in ${HOSTALIASES} filedns_getcanonname: trying %s.%s (%s) MX???AANY NO: errno=%d, h_errno=%d YES qdcount failure (%d) DNS failure: CNAME loop for %sDeferred: DNS failure: CNAME loop for %.100s%.*s%s%.*s.dns_getcanonname: %s HOSTALIASESdropenvelope %lx: id=, flags=sendq=dropenvelope, e_flags=0x%x, OpMode=%c, pid=%dBogus flags: dropenvelope: q_flags = %x, paddr = %sCannot send message within %sMessage could not be delivered for %s Message will be deleted from queue 4.4.7<>owner--requestWarning: could not send message for past %sWarning: message still undelivered after %s Will keep trying until message is %s old failure_return=%d delay_return=%d success_return=%d queueit=%d dropenvelope(%s): sending return receipt Return receiptdropenvelope(%s): saving mail dropenvelope(%s): sending postmaster copy dropenvelope(%s): at simpledrop, queueit=%d ===== Dropping [dq]f%s... queueit=%d, e_flags=donedropenvelope(%s): unlocking job dropenvelope dfclearenvelope xfpclearenvelope dfp%d%04d%02d%02d%02d%02dCan't create transcript file %s/dev/null!Can't open /dev/nulla!Can't create transcript stream %sopenxscript(%s): closexscriptsetsender(%s) %.*s@%.*ssetsender: %s: invalid or unparseable, received from %s5.1.7553 Invalid sender addressnpostmaster553 setsender: can't even parse postmaster!setsender: QDONTSEND //no/such/directoryHOMEcannot prescan from (%s)>@Saving from domain: DONT_MIMEIS_MIMEHAS_DFRET_PARAMCRLF_NOT_EOLNL_NOT_EOLHAS8BITNORECEIPTLOGSENDERMETOOPM_NOTIFYGLOBALERRSQUEUERUNWARNINGVRFYONLYRESENTRESPONSEDELETE_BCCFATALERRSSENDRECEIPTCLRQUEUENO_BODY_RETNINQUEUEOLDSTYLE%lx<%s,%s> 554451syserr: ExitStat = %d UID%d*~*SYSERR(%s): %.900slA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lAlAlAlA8lAlA8lAlA8lA8lAlA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lAlA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lA8lAlA501Postmaster warning: %.*s%.900s050--- %s%s%s (hold) (held)45%s --> %s%s%s%s %05d >>> %s 221SYSERR: putoutmsg (%s): error on output channel sending "%s": %sNO-HOST%3.3s%c%s: line %d: 551251%s... : %s with Connection reset by during %sHost %s is downConnection refused by %shost not foundhost name lookup failurenon-recoverable errorno data knownOperation not permittedTimeout on file openSymbolic links not allowedHard links not allowedRegular files onlyExecutable files not allowedWorld writable directoryGroup writable directoryFile changed after openWorld writable fileGroup writable fileName server: %s: chompheader: 553 header syntax error, line "%s"no header flags match header match, flags=%x, ruleset=%s resent-fromcomparing header from (%s) against default (%s or %s) full-name----- collected header ----- %s: () resent-message-id---------------------------- precedencepriorityurgentnormalnon-urgentposted-datedate8BITMIMEMIME-VersionContent-Type;/eatheader: setsender(*%s == %s) [RESPONSE]localhost%.80s (%.100s)from=%.200s, size=%ld, class=%d, pri=%ld, nrcpts=%d, msgid=%.100s, bodytype=%.20s, proto=%.20s%.850s, relay=%.100scrackaddr(%s) crackaddr=>`' --- putheader, mailer = %s --- %s: (skipped (content-transfer-encoding)) (skipped) (skipped (resent)) (skipped (receipt)) (skipped -- null value) (skipped -- bcc) %s:MIME-Version: 1.0Content-Type: text/plain; charset=%sContent-Transfer-EncodingContent-Transfer-Encoding: 8bit%.200s: %.*scommaize(%s: %s) , , expand() expand ==> expand: recursion too deep (%d max)%sdefine(%s as re***UNDEFINED MACRO***macid() => Name required for macro/classNULL %c Invalid macro/class character %cUnbalanced { on %sMacro/class name ({%s}) too long (%d chars max)Macro/class {%s}: too many long names0x%x main: reentered!sendmail, stdin, stdout, stderrFile descriptors missing on startup: %safter openlog0-99.1B:b:C:cd:e:F:f:h:IiM:mN:nO:o:p:q:R:r:sTtUV:vX:ANSI%sUnknown UID %dNon-setuid binary: RunAsUid = RealUid = %d Version %s Compiled with: OS Defines:Kernel symbols: %s /netbsd Def Conf file: %s Pid file: %s AGENTNAMEcanonical name: %s a.k.a.: %s uname failed (%s) UUCP nodename: %s [%.100s]newaliasesmailqsmtpdhoststatpurgestatFrozen configurations unsupportedInvalid operation mode %cMore than one "from" personBad hop count (%s)neversuccessfailuredelayInvalid -N argumentDuplicate -R flaghdrsfullInvalid -R valueInvalid syntax in -V flagacannot open %sTbefore readcfTZm ============ SYSTEM IDENTITY (after readcf) ============ (short domain name) $w = (canonical domain name) $j = (subdomain name) $m = (node name) $k = ======================================================== Processed by %s with -C %sProcessed from queue %s7BIT8BITMIMEIllegal body type %sHOSTALIASESWarning: .cf version level (%d) exceeds sendmail version %s functionality (%d)Warning: HostStatusDirectory disabled with ConnectionCacheSize = 0 Warning: HostStatusDirectory required for SingleThreadDelivery *~*user %d attempted to %srun daemonpurge host statusPermission denieddaemon invoked without full pathname; kill -1 won't workFj Sendmail v ready at bFrom g djWARNING: local host name (%s) is not qualified; fix $j in config filelocalNo local mailer definedprogNo prog mailer defined*file*No *file* mailer defined*include*No *include* mailer definedmultipart/signedrfc8227bit8bitbinaryQueueDirectory (Q) option must be setcannot chdir(%s)Cannot use HostStatusDirectory = %s: %s .main: cannot stat %sYou do not have permission to process the queuebefore main() initmapsADDRESS TEST MODE (ruleset 3 NOT automatically invoked) Enter
> > %s daemon: cannot fork+SMTP+queueing@+debuggingstarting daemon (%s): %s{client_name}{client_addr}%d0{client_port}%s set sender to %s using -%cRecipient names must be specifiedFrom person = "%s" main: QDONTSEND AAAAAAAAAAALAA,AAAAADAAAAtAAAAAAAAAAADAALAAAlADAAAADAAADAAAdAxAADALAtAtAtALAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtAtALAtAtALAtAtAtALALAtAtAtALAtAtALAtAtALALAtALAtAtAtA`AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAApBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhBhB0BhBhBhB8BBhBhBhBhBhBhBBhBhB,B ====finis: stat %d e_id=%s e_flags=NOQUEUEfinis, pid=%dinterruptMAILER-DAEMONopModedisconnect: In %d Out %d, e=%lx don't disconnect level %d/dev/nullrdisconnectin background, pid=%dsendmail.cf-q0-d0-99.1%s: X-Authentication-WarningAuthentication-Warning: %.400ssetuserenv: putenv(%s) failed--- dumping state on %s: $j = %s ---*** $j not in $=w ***CurChildren = %d--- open file descriptors: ------ connection cache: ---debug_dumpstate--- ruleset debug_dumpstate returns stat %d, pv: ------ end of state dump ---user signalcould not restart: need full pathrestarting %s on signalcould not set[ug]id(%d, %d): %mcould not exec %s: %mdrop_privileges(%d): Real[UG]id=%d:%d, RunAs[UG]id=%d:%d fill_fd: %s: fd %d not open!fill_fd: %s: cannot open /dev/nullstartup-btUsage: .[DC]macro value(s) Unknown "." command %s Undefined ruleset %s Usage: =Sruleset or =M Unknown "=" command %s Usage: -d{debug arguments} Unknown "-" command %s Undefined Usage: /[canon|map|mx|parse|try|tryflags] mxUsage: /mx address getmxrr(%s) returns %d value(s): %s canonUsage: /canon address Name too long getcanonname(%s) returns %s mapUsage: /map mapname key No key specified Map named "%s" not found Map named "%s" not open map_lookup: %s (%s) no match (%d) returns %s (%d) tryUsage: /try mailer address Unknown mailer %s Trying %s %s address %s for mailer %s headerenvelopesenderrecipientRcode = %d, addr = %s tryflagsUsage: /tryflags [Hh|Ee][Ss|Rr] parseUsage: /parse address Cracked address = Parsing %s %s address Cannot parse mailer %s, host %s, user %s mailer %s, user %s Unknown "/" command %s No address! == Ruleset %s (%d) status %d AB?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?B?BAB|3B?B?B?B?B?B?B?B?B 3B+B4B?B?B?B?B?B?B?B?B?B?B?B?B?B<.B?B|+B %s entering initmapsexiting initmapsmap_init(%s:%s, %s, %d) NULL wrong pass (pass = %d, rebuildable = %d) %s:%s %s: valid %s:%s %s: invalid: %s hostsgetcanonname(%s), trying %s filesnisdnsgetcanonname(%s), found .getcanonname(%s), failed, stat=%d %sbt_map_open(%s, %s, %d) btreehash_map_open(%s, %s, %d) hash.db unsafe map file: %s %s map "%s": unsafe map file %sCannot open %s database %sdb_map_open(%s): file changed after opendb_map_lookup(%s, %s) Cannot reopen DB database %sdb_map_lookup: get (%s)db_map_store(%s, %s, %s) 050 Warning: duplicate alias name %s%s,%sdb_map_store append=%s readaliases: db put (%s)db_map_close(%s, %s, %lx) @readaliases: db close failurenis_map_open(%s, %s, %d) mail.aliases421 NIS map %s specified, but NIS not runningnis_map_open: yp_match(@, %s, %s) => %s 421 Cannot bind to map %s in domain %s: %snis_map_lookup(%s, %s) nis_getcanonname(%s) hosts.bynamegot record `%s' text_map_open(%s, %s, %d) text map "%s": file name requiredtext map "%s": file name must be fully qualified unsafe map file: %d text map "%s": unsafe map file %stext map "%s", file %s: -k should specify a number, not %stext map "%s", file %s: -v should specify a number, not %stext_map_open(%s, %s): delimiter = (white space) %c text_map_lookup(%s, %s) text_getcanonname(%s) r# stab_lookup(%s, %s) stab_map_open(%s, %s, %d) impl_map_lookup(%s, %s) impl_map_store(%s, %s, %s) impl_map_open(%s, %s, %d) WARNING: cannot open alias database %simpl_map_close(%s, %s, %lx) user_map_open(%s, %d) namepasswduidgidgecosdirshellUser map %s: unknown column name %suser_map_lookup(%s, %s) %dBBBBBTB`BlBprog_map_lookup(%s, %s) %s prog_open: %sprog_map_lookup(%s) failed (%s) -- closingprog_map_lookup(%s): read error %s prog_map_lookup(%s): empty answer prog_map_lookup(%s): wait error %s prog_map_lookup(%s): child died on signal %dseq_map_parse(%s, %s) Sequence map %s: unknown member map %sSequence map %s: too many member maps (%d max)switch_map_open(%s, %s, %d) switch_map_find => %d %s %s.%sSwitch map %s: unknown member map %s map_stack[%d] = %s:%s seq_map_close(%s) seq_map_lookup(%s, %s) seq_map_store(%s, %s, %s) seq_map_store(%s, %s, %s): no writable mapbogus-mapmci_cache: caching %lx (%s) in slot %d mci_cache: caching %x (%.100s) in slot %dmci_uncache: uncaching %lx (%s) from slot %d (%d) mci_uncache: uncaching %x (%.100s) from slot %d (%d)Closing connection to %smci_uncachemci_inmci_outnegative mno %d (%s)mci_get(%s %s): mci_state=%d, _flags=%x, _exitstat=%d, _errno=%d INMIMECVT7TO88BITOKDSNCVT8TO7INHEADERMULTSTAT7BIT8BITMIMESIZEEXPNESMTPCACHEDTEMPVALID MCI@%x: NULLflags=%x%s,,%serrno=%d, herrno=%d, exitstat=%d, state=%d, pid=%d,%smaxsize=%ld, phase=%s, mailer=%s,%sstatus=%s, rstatus=%s,%shost=%s, lastuse=%s%.1000s%s mci_lock_host: NULL mci mci_lock_host: attempting to lock %s mci_lock_host: Failed to generate host path for %s mci_lock_host: cannot create host lock file %smci_lock_host: couldn't get lock on %s mci_lock_host: Sanity check -- lock is good mci_unlock_host: NULL mci mci_unlock_host: stat file already locked mci_unlock_host: store prior to unlock mci_load_persistent: NULL mci mci_load_persistent: Attempting to load persistent information for %s mci_load_persistent: Couldn't generate host path mci_load_persistent: open(%s): %s mci_read_persistent: NULL fpmci_read_persistent: NULL mcimci_read_persistent: fp=%lx, mci=Unknown host status version %d: %d maxUnknown host status line "%s"BĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBĮBBBĮBĮBBĮBĮBĮBĮBĮBĮBĮBĮBĮBHBԭBĮBB8Bmci_store_persistent: NULL mci mci_store_persistent: Storing information for %s mci_store_persistent: no statfile V0 E%d H%d S%d D%.80s R%.80s U%ld . mci_traverse: pathname is %s mci_traverse: Failed to stat %s: %s mci_traverse: opendir %s: %s mci_traverse: path "%s" too long -------------- Hostname --------------- How long ago ---------Results--------- mci_print_persistent: cannot open %s: %s %s: could not read status file%c%-39s %12s %.*s Deferred: %.*s Unknown mailer error %dOK OK: %.*s mci_purge_persistent: purging %s mci_purge_persistent: failed to unlink %s: %s mci_purge_persistent: dpurge %s mci_purge_persistent: rmdir %s: %s mci_generate_persistent_path: null hostmci_generate_persistent_path: null pathmci_generate_persistent_path(%s): FAILURE %d SUCCESS %s FINALINTERMEDNOTSEPSYNTAXmime8to7: flags = %x, boundaries = %s Content-Transfer-EncodingContent-Typemessage/rfc822text/plainpvp[%d] = "%s" /;=-none-%.100s/%.100smultipartdigestboundarymime8to7: Content-Type: "%s": %s boundarymissingbogus---mime8to7: multipart boundary "%s" too longmime8to7: multipart boundary "%s" mime8to7: multipart nesting boundary too deep ...%s--%s ...%s +++after collect+++after putheader--%s-- mime8to7=>%s (multipart) messageMIME-VersionMIME-Version: 1.0mime8to7: cannot ftell on df%smime8to7: cannot fseek on df%smime8to7: %ld high bit(s) in %ld byte(s), cte=%s, type=%s/%s [none]binaryContent-Transfer-Encoding: %.200s ...Content-Transfer-Encoding: base64 Content-Transfer-Encoding: base64X-MIME-Autoconverted: from 8bit to base64 by %s id %s!"#$@[\]^`{|}~ ...Content-Transfer-Encoding: quoted-printable Content-Transfer-Encoding: quoted-printableX-MIME-Autoconverted: from 8bit to quoted-printable by %s id %sFrom mime8to7=>%s (basic) mimeboundary: line="%s"... --%s unknown-8bitmime7to8: unparsable CTE %sContent-Transfer-Encoding: %sContent-Transfer-Encoding: 8bitX-MIME-Autoconverted: from %.200s to 8bit by %s id %sbase64 mime7to8 => %s to 8bit done --parseaddr(%s) parseaddr-->NULL parseaddr-->bad address Transient parse error -- message queued for future deliveryDeferring message until queue runparseaddr: queuing message 4.4.3parseaddr-->553 Address too long (%d bytes max)553 Address contained invalid control charactersallocaddr(flags=%x, paddr=%s) .:@[]()<>,; prescan: 553 Address too long653 Unbalanced '"'653 Unbalanced '('653 Unbalanced '<'c=%c, s=%d; 653 Unbalanced ')'653 Unbalanced '>'ns=%02o 653 Illegal character %c653 Illegal character 0x%02xtok=553 prescan: too many tokens553 prescan: token too longprescan==>prescan: null leading token rewrite: ruleset %3d input:554 rewrite: illegal ruleset number %drewrite: excessive recursion (max %d), ruleset %d-----trying rule:554 Infinite loop in ruleset %d, rule %dworkspace: ADVANCE rp=, ap= EXTEND rp=CLMATCH rewrite: LHS $&%s => "%s" (NULL)BACKUP rp=----- rule fails -----rule matches:554 rewrite: ruleset %d: replacement $%c out of bounds$%c: %lx="%s"554 rewrite: expansion too longrewrite: RHS $&%s => "%s" host554 rewrite: map %s not foundrewritten as:rewrite: ruleset %3d returns:C C C C C C C C C C C C C CCCC$CC C C, CUnknown ruleset %s-----callsubr %s (%d) 554 callsubr: expansion too longmap_lookup(%s, %s) => DEFERRED map_lookup(%s, %s) => %s (%d) NOT FOUNDmap_lookup(%s, %s) tempfail: errno=%d %.80s map: lookup (%s): deferredconfigprotocoltempfailsoftwareunavailablenohostnouserusageERRORbuildaddr, flags=%x, tv=554 buildaddr: no mailer in parsed address*error*554 buildaddr: no usererror %s553 %s554 buildaddr: unknown mailer %s554 buildaddr: no host:include:buildaddr => QRCPTOKQTHISPASSQDELAYEDQDELIVEREDQEXPANDEDQRELAYEDQHASNOTIFYQPINGONDELAYQPINGONFAILUREQPINGONSUCCESSQUNSAFEADDRQBOGUSSHELLQVERIFIEDQSELFREFQNOTREMOTEQSENTQQUEUEUPQPRIMARYQGOODUIDQBADADDRQDONTSEND[NULL] %lx=NULL%s: mailer %d (%s), host `%s' user `%s', ruser `%s' next=%lx, alias %lx, uid %d, gid %d flags=%lx<,%s> owner=%s, home="%s", fullname="%s" (none) orcpt="%s", statmta=%s, status=%s rstatus="%s" specificity=%d, statdate=%s <>remotename(%s) g@remotename => `%s' maplocaluser: maplocaluser: cannot prescan %s maplocaluser: rewrite tempfail maplocaluser: doesn't resolve maplocaluser: address unchanged maplocaluser: QDONTSEND rscheck(%s, %s, %s) %s%c%srscheck: cannot prescan input: "%s", arg2=%s, relay=%sruleset=%s, arg1=%s%s, reject=%squeueup: cannot create %s, uid=%d: %squeueup: cannot lock %s: %sw!queueup: cannot create queue temp file %s, uid=%d >>>>> queueing %s%s >>>>> (new id) e_flags= sendq= tfp= lockfp=NULL !queueup: cannot create data temp file %s, uid=%dqueueup dfpV%d T%ld K%ld N%d P%ld I%d/%d/%ld B%s M%s F%s $r%s $s%s $_%s S%s Z%s dropenvelope: q_flags = %x, paddr = %sQ%s %s queuedqueueing fH%s: %s . !552 Error writing control file %s!452 Error writing control file %scannot rename(%s, %s), uid=%dqueueup lockfpqueueup, qf=%s<<<<< done queueing %s <<<<< C CC%s:%ld:%ld:%s Skipping queue run -- load average too high458 %s *~*runqueue: %sSkipping queue run -- fork() failed458 %s: %s runqueue: %s: %srunning queue: %srunqueue %s, pid=%d, forkflag=%dAborting queue run: load average too high%sSkipping %s (sequence %d of %d) and flushing rest of queuerunqueue: Flushing queue from %s (pri %ld, LA %d, %d of %d)Skipping %s (sequence %d of %d)Running %s (sequence %d of %d)orderq: QueueLimitId = %s QueueLimitSender = %s QueueLimitRecipient = %s .orderq: cannot open "%s" as "."orderq: checking %s WorkList for %s maxed out at %drorderq: cannot open %s: %s skipping %s (%x) %32s: pri=%ld \lClClClClCjClCkC lCjClCjCgrow_wlist: WorkListSize=%d grew WorkList for %s to %dFAILED to grow WorkList for %s to %dgrow_wlist: WorkListSize now %d dowork(%s) dowork: cannot fork%s: from queuedowork, pid=%dreadqf(%s) failed r+readqf(%s): fopen failure (%s) readqf: no control file %s%s: locked lockedreadqf(%s): fstat failure (%s) bogus queue file, uid=%d, mode=%oreadqf(%s): bogus file bogus file uid in mqueue+++++ %s SECURITY ALERT: extra data in qf: %sbogus queue lineVersion number in qf (%d) greater than max (%d)unsupported qf file version%s: too young (%s) too young (%s)From SECURITY ALERT: bogus qf line %sreadqf: %s: line %d: bad line "%s"unrecognized linereadqf: cannot open %sC$?$.$[$]$($)Inappropriate use of %s on LHSR line: null LHSreplacement $%c out of bounds$*$+$-$=$~Inappropriate use of %s on RHSR line: null RHSWARNING: Ruleset %s has multiple definitions %sinvalid argument to V line: "%.20s"invalid V line vendor code: "%s"unknown control line "%s"I/O read errorhostsdnsCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC0ChCCԨCCCCC CC0CdCCC CCCC(CTimeouts: connect = %ld initial = %ld helo = %ld mail = %ld rcpt = %ld datainit = %ld datablock = %ld datafinal = %ld rset = %ld quit = %ld nextcommand = %ld miscshort = %ld ident = %ld fileopen = %ld settimeout(%s = %s) initialmailrcptdatainitdatablockdatafinalcommandrsetheloquitmiscidentfileopenconnecticonnect*normalurgentnon-urgentsettimeout: invalid queuewarn subtimeout %ssettimeout: invalid queuereturn subtimeout %shoststatussettimeout: invalid timeout %ssendtolist: null listsendto: %s ctladdr=sendtolist: QSELFREF sendtolist: QDONTSEND recipient (%d): 5.4.6554 aliasing/forwarding loop broken (%d aliases deep; %d max)5.7.1550 Cannot mail directly to programs550 UID %d is an unknown user: cannot mail to programs550 User %s@%s doesn't have a valid shell for mailing to programs550 Address %s is unsafe for mailing to programs%s in sendq: duplicate suppressedat trylocaluser %s 550 Cannot mail directly to :include:sincluding file %sinclude %s: transient error: %s451 Cannot open %s: %s5.2.4550 Cannot open %s: %s550 Cannot mail directly to files550 UID %d is an unknown user: cannot mail to files550 User %s@%s doesn't have a valid shell for mailing to files550 Address %s is unsafe for mailing to files/dev/nullDeferred: user database errordeferred: udbexpand: %squeued (user database error): %srecipient: testing local? cl=%d, rr5=%lx 5.1.1554 aliasing/forwarding loop for %s broken/testselfdestruct: SENDQ: ---- 554 aliasing/forwarding loop broken%s... expanded to multiple addresses finduser(%s): found (non-fuzzy) found (lower case) not found (fuzzy disabled) fuzzy matches %s sending to login name %sno fuzzy match found writable(%s, 0x%x) include(%s) ruid=%d euid=%d ctladdr include: old uid = %d/%d seteuid(%d) failure (real=%d, eff=%d)include: new uid = %d/%d include: not safe (uid=%d): %s rinclude: open: %s include: file changed after open seteuid(0) failure (real=%d, eff=%d)include: reset uid = %d/%d 451 open timeout on %sCannot fstat %s!include: parent of %s is %s, chown is %ssafe safedangerousun/SENDMAIL/ANY/SHELL/%s: user %s has bad shell %s, marked %sbogusunsafeinclude%s: %s writable %s file, marked unsafeworldgroupforward:include:%s to %sforwardingsendingforward %.200s => %sinclude: read error: %s include: QDONTSEND self_reference(%s) ... no self ref ... getpwnam(%s)... found failed ... cannot break loop for "%s" safefile(%s, uid=%d, gid=%d, flags=%x, mode=%o): pathname too long . %s / [final dir %s uid %d mode %lo] %s [slink mode %o] E_SM_NOSLINK [non-reg mode %o] E_SM_REGONLY [write bits %o] E_SM_%cWFILE [exec bits %o] E_SM_ISEXEC] [link count %d] E_SM_NOHLINK [uid %d, nlink %d, stat %lo, mode %lo] OK EACCES safedirpath(%s, uid=%ld, gid=%ld, flags=%x): [dir %s] mode %o 051 WARNING: writable directory %s [dir %s] %s 554 cannot open: file %s changed after openraww+a+r+safefopen: unknown omode %oxsafefopen: safeopen failed: %s safefopen: fdopen(%s, %s) failed: omode=%x, sff=%x, err=%s File changed after opening: nlink = %ld/%ld dev = %ld/%ld ino = %ld/%ld gen = %ld/%ld uid = %ld/%ld gid = %ld/%ld savemail, errormode = %c, id = %s, ExitStat = %d e_from=NONEPostmaster553 Cannot parse Postmaster!554 savemail: bogus errormode x%x state %d wn Message from %s... Errors occurred while sending mail. rCannot open %sTranscript of session is unavailable. Transcript follows: savemail transcriptOriginal message will be saved in dead.letter. postmaster553 cannot parse %s!z/dead.letterSaved message in %s savemail554 savemail: unknown state %dsavemail panic!554 savemail: cannot save rejected email anywhere^D@aD^DcDcD(eDgDUnable to deliver mail *** Return To Sender: msg="%s", depth=%d, e=%lx, returnq=Sendq=554 returntosender: infinite recursion on %sbinternallocalhostToreturn to senderpostmaster notifyDSN%s: %s: %sMIME-Version1.0%s.%ld/%.100smultipart/report; report-type=delivery-status; boundary="%s"Content-TypeContent-Transfer-Encodingbinary8bitWarning:Subjectwarning-timeoutPostmaster warning:postmaster-warningReturn receiptreturn-receiptPostmaster notify: %.*spostmaster-notificationReturned mail: %.*sfailureauto-generated (%s)Auto-Submitted553 Can't parse myself!Mail Delivery Subsystemerrbody: null parent ----- Original message lost ----- This is a MIME-encapsulated message--%ssubjectPostmaster ********************************************** ** THIS IS A WARNING MESSAGE ONLY ** ** YOU DO NOT NEED TO RESEND YOUR MESSAGE **The original message was received at %sfrom _ ----- The following addresses had permanent fatal errors -----%s (expanded from: %s) ----- The following addresses had transient non-fatal errors -----relayed to non-DSN-aware mailersuccessfully delivered to mailing listsuccessfully delivered to mailboxexpanded by alias ----- The following addresses had successful delivery notifications -----%s (%s) ----- Transcript of session is unavailable ----- ----- Transcript of session follows ----- errbody xscriptContent-Type: message/delivery-statusOriginal-Envelope-Id: %.800sReporting-MTA: dns; %.800sdnsReceived-From-MTA: %s; %.800sArrival-Date: %sfaileddelivered (to mailing list)delivered (to mailbox)relayed (to non-DSN-aware mailer)expanded (to multi-recipient alias)delayedOriginal-Recipient: %.800srfc822Final-Recipient: %s; %.800sFinal-Recipient: %s; %.700s@%.100sX-Actual-Recipient: %s; %.700s@%.100sX-Actual-Recipient: %s; %.800sAction: %s5.0.04.0.02.0.0Status: %sRemote-MTA: %s; %.800ssmtpDiagnostic-Code: %s; %.800sLast-Attempt-Date: %sWill-Retry-Until: %s ----- Original message follows ----- ----- Message header follows ----- Content-Type: %smessage/rfc822text/rfc822-headersContent-Transfer-Encoding: %s ----- Message body suppressed ----- ----- No message was collected ----- --%s--errbody: I/O error4.4.24.2.04.3.04.3.15.5.25.5.45.5.15.2.05.1.65.2.25.1.0ȍD܍DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD,DDD,DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD@DTDhD|DD0123456789abcdefbogus xtext: +%cbogus xtext: +%x%cwizdebugshowqxusronexverbetrnehloheloquitnoophelpexpnvrfyrsetdatarcptmaillocalhostserver %s startup*~*SMTP connect from %.100s (%.100s)220 %.*s ESMTP%s220-%.*s ESMTP%s220-%s220 %sserver cmd readserver %s cmd read421 %s Lost input channel from %slost input channel from %.100sNull connection from %.100s<<< %s <-- %s%s: %.80s%s %s: %.80s550 Access deniedESMTPserver EHLOSMTPserver HELOHELO/EHLO503 %s Duplicate HELO/EHLO501 %s requires domain address[].-_#pleased to meet you501 Invalid domain nameaccepting invalid domain name250 %s Hello %s, %s250-%s Hello %s, %s250-EXPN250-VERB250-8BITMIME250-SIZE %ld250-SIZE250-DSN250-ONEX250-ETRN250-XUSR250 HELPserver MAIL503 Polite people say HELO first503 Sender already specified503 Nested MAIL command: MAIL %sfromSMTP-MAIL%s didn't use HELO protocolcheck_mail%s owned process doing -bsMAIL: got arg %s="%s" 552 Message size exceeds fixed maximum message size (%ld)452 Insufficient disk space; try again later250 Sender ok503 Need MAIL before RCPTserver RCPT452 Too many recipientstocheck_rcptRCPT: got arg %s="%s" 250 Recipient ok%s (will queue)550 Addressee unknownserver DATA503 Need MAIL command503 Need RCPT (recipient)collectdeliveryw250 %s Message accepted for delivery451 Test failure250 Reset stateVRFYEXPN252 Cannot VRFY user; try RCPT to attempt delivery (or try finger)502 Sorry, we do not allow this operation%.100s: %s [rejected]503 I demand that you introduce yourself firstSMTP-VRFYSMTP-EXPN%.100s: %s501 Argument required554 Nothing to %s500 Parameter requiredETRN%.100s: ETRN %s250 Queuing for node %s startedNOOP250 OK221 %s closing connection502 Verbose unavailableVERB250 Verbose modeONEX250 Only one transactionXUSR250 Initial submission"%s" command from %.100s (%.100s)421 %s Too many bad commands; closing connection500 Command unrecognized: "%s"500 smtp: unknown code %dDHD\DDDDDDDtDtDtDDxDxDxDDD DxDxDxDxDxDxDxD%.100s: %.40s attack?501 Syntax error in parameters scanning "%s"size501 SIZE requires a valuebody501 BODY requires a value8bitmime7bit501 Unknown BODY type %senvid501 ENVID requires a value501 Syntax error in ENVID parameter value501 Duplicate ENVID parameterret501 RET requires a value501 Duplicate RET parameterhdrsfull501 Bad argument "%s" to RET501 %s parameter unrecognizednotify501 NOTIFY requires a valueneversuccessfailuredelay501 Bad argument "%s" to NOTIFYorcpt501 ORCPT requires a value501 Syntax error in ORCPT parameter value501 Duplicate ORCPT parameter252250<%s@%s><%s>%s <%s@%s>%s <%s>451 %s: cannot forkserver %s child wait451 %s: lost child451 %s: died on signal %d502 Sendmail %s -- HELP not implementedsmtp214-This is Sendmail version %s214-%s504 HELP topic "%.10s" unknown214 End of HELP infoSTAB: %s %d (hfunc=%d) not found type %d val %lx %lx %lx %lx entered stabapply: trying %d/%s 554 Local configuration error:550 Insufficient permission 554 Remote protocol error 250 Deferred:451 I/O error:550 Can't create output:554 System file missing:451 Operating system error:554 Internal error 554 Service unavailable 550 Host unknown 550 User unknown:550 Cannot open input 501 Data format error 500 Bad usagelDDD$D,DdDlDtDtDDDDlDDDDD\DD\DDdDD|DlDudbexpand(%s) :maildropudbexpand: trying %s (%d) via db udbexpand: no match on %s (%d) udbexpand: match %.*s: %.*s expanded to %sexpand %.100s => %sudbexpand: QDONTSEND udbexpand: db-get %.*s stat %d:mailsenderMessage delivered to mailing list %s %s@%smailnameudbmatch(%s, %s) :udbmatch: no match on %s (%d) via db udbmatch ==> %s :default:mailname@udb_map_lookup(%s, %s) .dbdbopen(%s): %s dbopen(%s): %sUnknown UDB spec %sREMOTE: addr %s, timeo %d FETCH: file %s FORWARD: host %s HESIOD UNKNOWN smtpinit 451 smtpinit: state CLOSEDclient greeting%s %s: %sEHLO %sclient EHLOHELO %sclient HELO553 %s config error: mail loops back to me (MX problem?)VERB4.4.24.5.05.5.0|DDE(DDTDTDESMTP8BIT-OKsize8bitmimeexpndsnsmtpmailfrom: CurHost=%s SIZE=%ld8BITMIME BODY=%s does not support 8BITMIME5.6.3 ENVID= RET=HDRSFULLgMAIL From:<%s>%sMAIL From:<@%s%c%s>%sclient MAIL5.5.25.1.35.2.25.0.0%.100s: SMTP MAIL protocol error: %s5.5.1 NOTIFY=SUCCESS,FAILUREDELAYNEVER ORCPT=RCPT To:<%s>%sclient RCPT5.1.15.1.6%.100s: SMTP RCPT protocol error: %sDATAclient DATA 354%.100s: SMTP DATA-1 protocol error: %s451 timeout writing message to %s.%s%05d >>> . >>> .client DATA status%.100s: SMTP DATA-2 protocol error: %sclient QUITQUITclient RSETRSETclient probereply 451 reply: read error from %s%s... reply(%.100s) during %sEHLO... while talking to %s: >>> %s <<< %s 050 %s%s>>> %s%05d >>> %s %s%s smtpmessage: NULL mci_out !Out of memory!! %08lx=%s%s%s%s$=~&?{%s}%c%s$%c%sM-%05d >>> From ! %05d >>> unlink %s%s: unlink-fail %dxfclose(%lx) %s %s xfclose(%s %s): fd = 1xfclose FAILURE: %s timeout waiting for input from %.100s during %slocal%05d <<< [TIMEOUT] %05d <<< [EOF] %05d <<< %stTyYcheckfdopen(%d): %s not open as expected!%s: changed fds:%3d: CANNOT STAT (%s)CLOSEDfl=0x%x, mode=%o: SOCK (%s)%s/%d->CHR: BLK: FIFO: DIR: LNK: dev=%d/%d, ino=%d, nlink=%d, u/gid=%d/%d, size=%qddev=%d/%d, ino=%d, nlink=%d, u/gid=%d/%d, size=%ld%.800s%s ...%s: cannot create pipe for stdout%s: cannot fork%s: cannot dup2 for stdout%s: cannot dup2 for stderrprog_open: setgid(%ld) failedprog_open: setuid(%ld) failed/tmp/%s: cannot exec !#$%&'*+-./^_`{|}~POSSIBLE ATTACK from %.100s: newline in string "%s"[UNKNOWN]proc_list_probe: lost pid %d  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~pF@(#)alias.c 8.73 (Berkeley) 5/8/97@(#)arpadate.c 8.7 (Berkeley) 2/1/97@(#)clock.c 8.24 (Berkeley) 4/19/97@(#)collect.c 8.72 (Berkeley) 10/6/97H(FD(F@(F<(F8(F4(F0(Fx(Ft(Fp(Fl(Fh(Fd(F`(F\(FX(FT(FP(FL(F@(#)conf.c 8.379 (Berkeley) 10/20/97*F)F)F)F)F)F)F )F )F)F)F )F|)F x)F@l)F @\)FP)F<)F4)F,)F$)F)F )F(F(F(F(F@(F`(F(F (F (F*F*Ft*Fd*F\*FT*FD*F4*F $*F *F@*F2@(#)$Id: conf.c,v 1.20.2.1 1997/11/10 05:50:51 thorpej Exp $4F4F4F4F4F4F4F4F4F4F4F4Fx4Fl4Fd4F\4F5F5F5F5F5F5F5F5F5Ft5Fh5F\5FP5FD5F85F,5F 5F5F5F4F4F@(#)convtime.c 8.9 (Berkeley) 2/1/97@(#)daemon.c 8.195 (Berkeley) 10/23/97 (with daemon mode) @(#)deliver.c 8.296 (Berkeley) 10/22/97@(#)domain.c 8.68 (Berkeley) 8/2/97 (with name server)@(#)envelope.c 8.105 (Berkeley) 6/24/97|YFtYFdYFXYFLYF@YF 4YF@(YF YFYF YFYFXFXF XF@XFXFXFXFXFXFXF XF@|XF@(#)err.c 8.65 (Berkeley) 10/18/97@(#)headers.c 8.115 (Berkeley) 10/22/97@(#)macro.c 8.18 (Berkeley) 2/1/97@(#) Copyright (c) 1988, 1993 The Regents of the University of California. All rights reserved. @(#)main.c 8.258 (Berkeley) 10/20/97@(#)sendmail.h 8.245 10/22/97 cF cF cF*+-=~#@:>?|.[]()&@(#)map.c 8.186 (Berkeley) 10/21/97|F3C3C2C2C@(#)mci.c 8.66 (Berkeley) 8/2/97\FTFLFDF?456789:;<=  !"#$%&'()*+,-./0123  @(#)parseaddr.c 8.132 (Berkeley) 10/20/97 !"3$5 "3$555 !"3$F@ܘFCԘFDȘFEFFFKFLFNEFFFFFFF xF@lF`FTFHF8F(F F@ FFFFܙFЙF@șF@(#)queue.c 8.175 (Berkeley) 10/4/97 (with queueing)@(#)readcf.c 8.201 (Berkeley) 10/1/97FFFFF F@F|FtFlFLF7ACpFF@EFFFF0FFD FPFFF@\*F@̿BpFFF*CFF@FB( F)pFF))+B FFpF F FF@0)`F+@`> K Z@ ZPQpFpY@_@@hPP m((xsP+(xP(IXr